The Role of Vitamin D Deficiency in Children With Recurrent Wheezing—Clinical Significance

Recurrent wheezing (RW) in infancy is one of the most frequent reasons for parents to consult health care providers and creates a significant global burden. Clinical course of RW is difficult to predict, also which infants will progress to asthma, since no valid biomarkers have been established. Ide...

Full description

Bibliographic Details
Main Authors: Gavriela Feketea, Corina I. Bocsan, Luminita Aurelia Stanciu, Anca Dana Buzoianu, Mihnea Tudor Zdrenghea
Format: Article
Language:English
Published: Frontiers Media S.A. 2020-06-01
Series:Frontiers in Pediatrics
Subjects:
Online Access:https://www.frontiersin.org/article/10.3389/fped.2020.00344/full
id doaj-66f95209d8ee4a28b4dc33b87c117534
record_format Article
spelling doaj-66f95209d8ee4a28b4dc33b87c1175342020-11-25T03:14:23ZengFrontiers Media S.A.Frontiers in Pediatrics2296-23602020-06-01810.3389/fped.2020.00344514031The Role of Vitamin D Deficiency in Children With Recurrent Wheezing—Clinical SignificanceGavriela Feketea0Gavriela Feketea1Corina I. Bocsan2Luminita Aurelia Stanciu3Anca Dana Buzoianu4Mihnea Tudor Zdrenghea5Mihnea Tudor Zdrenghea6Department of Hematology, “Iuliu Hatieganu” University of Medicine and Pharmacy, Cluj-Napoca, RomaniaDepartment of Pediatrics, Pediatric Allergy Outpatient Clinic, “Karamandaneio” Children Hospital, Patras, GreeceDepartment of Pharmacology, Toxicology and Clinical Pharmacology, “Iuliu Hatieganu” University of Medicine and Pharmacy, Cluj-Napoca, RomaniaAirways Disease Infection Section, National Heart and Lung Institute, Imperial College London, London, United KingdomDepartment of Pharmacology, Toxicology and Clinical Pharmacology, “Iuliu Hatieganu” University of Medicine and Pharmacy, Cluj-Napoca, RomaniaDepartment of Hematology, “Iuliu Hatieganu” University of Medicine and Pharmacy, Cluj-Napoca, RomaniaDepartment of Hematology, Ion Chiricuta Oncology Institute, Cluj-Napoca, RomaniaRecurrent wheezing (RW) in infancy is one of the most frequent reasons for parents to consult health care providers and creates a significant global burden. Clinical course of RW is difficult to predict, also which infants will progress to asthma, since no valid biomarkers have been established. Identification of those infants with RW who are at risk of further recurrences and/or severe acute respiratory tract infection (ARTI) could help pediatricians to improve their therapeutic decisions. Increasing research interest is focused on the extra-skeletal actions of vitamin D (VD) and the clinical impact of VD insufficiency/deficiency. As VD deficiency could be a risk factor for causing RW in children, measurement of their serum level of 25-hydroxycholecalciferol [25(OH)D] is recommended. In the case of deficiency, VD administration is recommended in age-appropriate doses for at least 6 weeks, until achievement of normal blood 25(OH)D level, followed by supplementation as long as exposure to sun is inadequate. Higher doses of VD given in an attempt to prevent asthma development appear to be of no additional benefit. In children with severe ARTI, VD level is recommended to be assess.https://www.frontiersin.org/article/10.3389/fped.2020.00344/fullvitamin D25(OH)Dvitamin D receptor (VDR)recurrent wheezingasthmarespiratory allergies
collection DOAJ
language English
format Article
sources DOAJ
author Gavriela Feketea
Gavriela Feketea
Corina I. Bocsan
Luminita Aurelia Stanciu
Anca Dana Buzoianu
Mihnea Tudor Zdrenghea
Mihnea Tudor Zdrenghea
spellingShingle Gavriela Feketea
Gavriela Feketea
Corina I. Bocsan
Luminita Aurelia Stanciu
Anca Dana Buzoianu
Mihnea Tudor Zdrenghea
Mihnea Tudor Zdrenghea
The Role of Vitamin D Deficiency in Children With Recurrent Wheezing—Clinical Significance
Frontiers in Pediatrics
vitamin D
25(OH)D
vitamin D receptor (VDR)
recurrent wheezing
asthma
respiratory allergies
author_facet Gavriela Feketea
Gavriela Feketea
Corina I. Bocsan
Luminita Aurelia Stanciu
Anca Dana Buzoianu
Mihnea Tudor Zdrenghea
Mihnea Tudor Zdrenghea
author_sort Gavriela Feketea
title The Role of Vitamin D Deficiency in Children With Recurrent Wheezing—Clinical Significance
title_short The Role of Vitamin D Deficiency in Children With Recurrent Wheezing—Clinical Significance
title_full The Role of Vitamin D Deficiency in Children With Recurrent Wheezing—Clinical Significance
title_fullStr The Role of Vitamin D Deficiency in Children With Recurrent Wheezing—Clinical Significance
title_full_unstemmed The Role of Vitamin D Deficiency in Children With Recurrent Wheezing—Clinical Significance
title_sort role of vitamin d deficiency in children with recurrent wheezing—clinical significance
publisher Frontiers Media S.A.
series Frontiers in Pediatrics
issn 2296-2360
publishDate 2020-06-01
description Recurrent wheezing (RW) in infancy is one of the most frequent reasons for parents to consult health care providers and creates a significant global burden. Clinical course of RW is difficult to predict, also which infants will progress to asthma, since no valid biomarkers have been established. Identification of those infants with RW who are at risk of further recurrences and/or severe acute respiratory tract infection (ARTI) could help pediatricians to improve their therapeutic decisions. Increasing research interest is focused on the extra-skeletal actions of vitamin D (VD) and the clinical impact of VD insufficiency/deficiency. As VD deficiency could be a risk factor for causing RW in children, measurement of their serum level of 25-hydroxycholecalciferol [25(OH)D] is recommended. In the case of deficiency, VD administration is recommended in age-appropriate doses for at least 6 weeks, until achievement of normal blood 25(OH)D level, followed by supplementation as long as exposure to sun is inadequate. Higher doses of VD given in an attempt to prevent asthma development appear to be of no additional benefit. In children with severe ARTI, VD level is recommended to be assess.
topic vitamin D
25(OH)D
vitamin D receptor (VDR)
recurrent wheezing
asthma
respiratory allergies
url https://www.frontiersin.org/article/10.3389/fped.2020.00344/full
work_keys_str_mv AT gavrielafeketea theroleofvitaminddeficiencyinchildrenwithrecurrentwheezingclinicalsignificance
AT gavrielafeketea theroleofvitaminddeficiencyinchildrenwithrecurrentwheezingclinicalsignificance
AT corinaibocsan theroleofvitaminddeficiencyinchildrenwithrecurrentwheezingclinicalsignificance
AT luminitaaureliastanciu theroleofvitaminddeficiencyinchildrenwithrecurrentwheezingclinicalsignificance
AT ancadanabuzoianu theroleofvitaminddeficiencyinchildrenwithrecurrentwheezingclinicalsignificance
AT mihneatudorzdrenghea theroleofvitaminddeficiencyinchildrenwithrecurrentwheezingclinicalsignificance
AT mihneatudorzdrenghea theroleofvitaminddeficiencyinchildrenwithrecurrentwheezingclinicalsignificance
AT gavrielafeketea roleofvitaminddeficiencyinchildrenwithrecurrentwheezingclinicalsignificance
AT gavrielafeketea roleofvitaminddeficiencyinchildrenwithrecurrentwheezingclinicalsignificance
AT corinaibocsan roleofvitaminddeficiencyinchildrenwithrecurrentwheezingclinicalsignificance
AT luminitaaureliastanciu roleofvitaminddeficiencyinchildrenwithrecurrentwheezingclinicalsignificance
AT ancadanabuzoianu roleofvitaminddeficiencyinchildrenwithrecurrentwheezingclinicalsignificance
AT mihneatudorzdrenghea roleofvitaminddeficiencyinchildrenwithrecurrentwheezingclinicalsignificance
AT mihneatudorzdrenghea roleofvitaminddeficiencyinchildrenwithrecurrentwheezingclinicalsignificance
_version_ 1724642647318986752