The Role of Vitamin D Deficiency in Children With Recurrent Wheezing—Clinical Significance
Recurrent wheezing (RW) in infancy is one of the most frequent reasons for parents to consult health care providers and creates a significant global burden. Clinical course of RW is difficult to predict, also which infants will progress to asthma, since no valid biomarkers have been established. Ide...
Main Authors: | , , , , |
---|---|
Format: | Article |
Language: | English |
Published: |
Frontiers Media S.A.
2020-06-01
|
Series: | Frontiers in Pediatrics |
Subjects: | |
Online Access: | https://www.frontiersin.org/article/10.3389/fped.2020.00344/full |
id |
doaj-66f95209d8ee4a28b4dc33b87c117534 |
---|---|
record_format |
Article |
spelling |
doaj-66f95209d8ee4a28b4dc33b87c1175342020-11-25T03:14:23ZengFrontiers Media S.A.Frontiers in Pediatrics2296-23602020-06-01810.3389/fped.2020.00344514031The Role of Vitamin D Deficiency in Children With Recurrent Wheezing—Clinical SignificanceGavriela Feketea0Gavriela Feketea1Corina I. Bocsan2Luminita Aurelia Stanciu3Anca Dana Buzoianu4Mihnea Tudor Zdrenghea5Mihnea Tudor Zdrenghea6Department of Hematology, “Iuliu Hatieganu” University of Medicine and Pharmacy, Cluj-Napoca, RomaniaDepartment of Pediatrics, Pediatric Allergy Outpatient Clinic, “Karamandaneio” Children Hospital, Patras, GreeceDepartment of Pharmacology, Toxicology and Clinical Pharmacology, “Iuliu Hatieganu” University of Medicine and Pharmacy, Cluj-Napoca, RomaniaAirways Disease Infection Section, National Heart and Lung Institute, Imperial College London, London, United KingdomDepartment of Pharmacology, Toxicology and Clinical Pharmacology, “Iuliu Hatieganu” University of Medicine and Pharmacy, Cluj-Napoca, RomaniaDepartment of Hematology, “Iuliu Hatieganu” University of Medicine and Pharmacy, Cluj-Napoca, RomaniaDepartment of Hematology, Ion Chiricuta Oncology Institute, Cluj-Napoca, RomaniaRecurrent wheezing (RW) in infancy is one of the most frequent reasons for parents to consult health care providers and creates a significant global burden. Clinical course of RW is difficult to predict, also which infants will progress to asthma, since no valid biomarkers have been established. Identification of those infants with RW who are at risk of further recurrences and/or severe acute respiratory tract infection (ARTI) could help pediatricians to improve their therapeutic decisions. Increasing research interest is focused on the extra-skeletal actions of vitamin D (VD) and the clinical impact of VD insufficiency/deficiency. As VD deficiency could be a risk factor for causing RW in children, measurement of their serum level of 25-hydroxycholecalciferol [25(OH)D] is recommended. In the case of deficiency, VD administration is recommended in age-appropriate doses for at least 6 weeks, until achievement of normal blood 25(OH)D level, followed by supplementation as long as exposure to sun is inadequate. Higher doses of VD given in an attempt to prevent asthma development appear to be of no additional benefit. In children with severe ARTI, VD level is recommended to be assess.https://www.frontiersin.org/article/10.3389/fped.2020.00344/fullvitamin D25(OH)Dvitamin D receptor (VDR)recurrent wheezingasthmarespiratory allergies |
collection |
DOAJ |
language |
English |
format |
Article |
sources |
DOAJ |
author |
Gavriela Feketea Gavriela Feketea Corina I. Bocsan Luminita Aurelia Stanciu Anca Dana Buzoianu Mihnea Tudor Zdrenghea Mihnea Tudor Zdrenghea |
spellingShingle |
Gavriela Feketea Gavriela Feketea Corina I. Bocsan Luminita Aurelia Stanciu Anca Dana Buzoianu Mihnea Tudor Zdrenghea Mihnea Tudor Zdrenghea The Role of Vitamin D Deficiency in Children With Recurrent Wheezing—Clinical Significance Frontiers in Pediatrics vitamin D 25(OH)D vitamin D receptor (VDR) recurrent wheezing asthma respiratory allergies |
author_facet |
Gavriela Feketea Gavriela Feketea Corina I. Bocsan Luminita Aurelia Stanciu Anca Dana Buzoianu Mihnea Tudor Zdrenghea Mihnea Tudor Zdrenghea |
author_sort |
Gavriela Feketea |
title |
The Role of Vitamin D Deficiency in Children With Recurrent Wheezing—Clinical Significance |
title_short |
The Role of Vitamin D Deficiency in Children With Recurrent Wheezing—Clinical Significance |
title_full |
The Role of Vitamin D Deficiency in Children With Recurrent Wheezing—Clinical Significance |
title_fullStr |
The Role of Vitamin D Deficiency in Children With Recurrent Wheezing—Clinical Significance |
title_full_unstemmed |
The Role of Vitamin D Deficiency in Children With Recurrent Wheezing—Clinical Significance |
title_sort |
role of vitamin d deficiency in children with recurrent wheezing—clinical significance |
publisher |
Frontiers Media S.A. |
series |
Frontiers in Pediatrics |
issn |
2296-2360 |
publishDate |
2020-06-01 |
description |
Recurrent wheezing (RW) in infancy is one of the most frequent reasons for parents to consult health care providers and creates a significant global burden. Clinical course of RW is difficult to predict, also which infants will progress to asthma, since no valid biomarkers have been established. Identification of those infants with RW who are at risk of further recurrences and/or severe acute respiratory tract infection (ARTI) could help pediatricians to improve their therapeutic decisions. Increasing research interest is focused on the extra-skeletal actions of vitamin D (VD) and the clinical impact of VD insufficiency/deficiency. As VD deficiency could be a risk factor for causing RW in children, measurement of their serum level of 25-hydroxycholecalciferol [25(OH)D] is recommended. In the case of deficiency, VD administration is recommended in age-appropriate doses for at least 6 weeks, until achievement of normal blood 25(OH)D level, followed by supplementation as long as exposure to sun is inadequate. Higher doses of VD given in an attempt to prevent asthma development appear to be of no additional benefit. In children with severe ARTI, VD level is recommended to be assess. |
topic |
vitamin D 25(OH)D vitamin D receptor (VDR) recurrent wheezing asthma respiratory allergies |
url |
https://www.frontiersin.org/article/10.3389/fped.2020.00344/full |
work_keys_str_mv |
AT gavrielafeketea theroleofvitaminddeficiencyinchildrenwithrecurrentwheezingclinicalsignificance AT gavrielafeketea theroleofvitaminddeficiencyinchildrenwithrecurrentwheezingclinicalsignificance AT corinaibocsan theroleofvitaminddeficiencyinchildrenwithrecurrentwheezingclinicalsignificance AT luminitaaureliastanciu theroleofvitaminddeficiencyinchildrenwithrecurrentwheezingclinicalsignificance AT ancadanabuzoianu theroleofvitaminddeficiencyinchildrenwithrecurrentwheezingclinicalsignificance AT mihneatudorzdrenghea theroleofvitaminddeficiencyinchildrenwithrecurrentwheezingclinicalsignificance AT mihneatudorzdrenghea theroleofvitaminddeficiencyinchildrenwithrecurrentwheezingclinicalsignificance AT gavrielafeketea roleofvitaminddeficiencyinchildrenwithrecurrentwheezingclinicalsignificance AT gavrielafeketea roleofvitaminddeficiencyinchildrenwithrecurrentwheezingclinicalsignificance AT corinaibocsan roleofvitaminddeficiencyinchildrenwithrecurrentwheezingclinicalsignificance AT luminitaaureliastanciu roleofvitaminddeficiencyinchildrenwithrecurrentwheezingclinicalsignificance AT ancadanabuzoianu roleofvitaminddeficiencyinchildrenwithrecurrentwheezingclinicalsignificance AT mihneatudorzdrenghea roleofvitaminddeficiencyinchildrenwithrecurrentwheezingclinicalsignificance AT mihneatudorzdrenghea roleofvitaminddeficiencyinchildrenwithrecurrentwheezingclinicalsignificance |
_version_ |
1724642647318986752 |