Immunization with the H5N1 Recombinant Vaccine Candidate Induces High Protection in Chickens against Vietnamese Highly Pathogenic Avian Influenza Virus Strains
<b>Abstrac</b><b>t: </b>Vietnam is one of the countries most affected worldwide by the highly pathogenic avian influenza (HPAI) virus, which caused enormous economic loss and posed threats to public health. Over nearly two decades, with the antigenic changes in the diversifie...
Main Authors: | , , , , , , , , |
---|---|
Format: | Article |
Language: | English |
Published: |
MDPI AG
2020-04-01
|
Series: | Vaccines |
Subjects: | |
Online Access: | https://www.mdpi.com/2076-393X/8/2/159 |
id |
doaj-b2979c05926147238d6a563f606bdc50 |
---|---|
record_format |
Article |
spelling |
doaj-b2979c05926147238d6a563f606bdc502020-11-25T02:10:45ZengMDPI AGVaccines2076-393X2020-04-01815915910.3390/vaccines8020159Immunization with the H5N1 Recombinant Vaccine Candidate Induces High Protection in Chickens against Vietnamese Highly Pathogenic Avian Influenza Virus StrainsHang Thi Thu Hoang0Chi Hung Nguyen1Ngan Thi Thuy Nguyen2An Dang Pham3Hang Thi Thu Nguyen4Thanh Hoa Le5Hanh Xuan Tran6Ha Hoang Chu7Nam Trung Nguyen8Institute of Biotechnology (IBT), Vietnam Academy of Science and Technology (VAST), Hanoi 100000, VietnamInstitute of Biotechnology (IBT), Vietnam Academy of Science and Technology (VAST), Hanoi 100000, VietnamInstitute of Biotechnology (IBT), Vietnam Academy of Science and Technology (VAST), Hanoi 100000, VietnamInstitute of Biotechnology (IBT), Vietnam Academy of Science and Technology (VAST), Hanoi 100000, VietnamVietnam Forestry University, Xuan Mai, Chuong My, Hanoi 100000, VietnamInstitute of Biotechnology (IBT), Vietnam Academy of Science and Technology (VAST), Hanoi 100000, VietnamNational Veterinary Joint Stock Company (NAVETCO), 29 Nguyen Dinh Chieu, Dist 1, Ho Chi Minh City 700000, VietnamInstitute of Biotechnology (IBT), Vietnam Academy of Science and Technology (VAST), Hanoi 100000, VietnamInstitute of Biotechnology (IBT), Vietnam Academy of Science and Technology (VAST), Hanoi 100000, Vietnam<b>Abstrac</b><b>t: </b>Vietnam is one of the countries most affected worldwide by the highly pathogenic avian influenza (HPAI) virus, which caused enormous economic loss and posed threats to public health. Over nearly two decades, with the antigenic changes in the diversified H5Ny viruses, the limited protective efficacy of the available vaccines was encountered. Therefore, it is necessary to approach a technology platform for the country to accelerate vaccine production that enables quick response to new influenza subtypes. This study utilized a powerful reverse genetics technique to successfully generate a recombinant H5N1 vaccine strain (designated as IBT-RG02) containing two surface proteins (haemagglutinin (HA) and neuraminidase (NA)) from the HPAI H5N1 (A/duck/Vietnam/HT2/2014(H5N1)) of the dominant clade 2.3.2.1c in Vietnam during 2012–2014. Importantly, the IBT-RG02 vaccine candidate has elicited high antibody titres in chickens (geometric mean titre (GMT) of 6.42 and 6.92, log<sub>2</sub> on day 14 and day 28 p.i., respectively). To test the efficacy, immunized chickens were challenged with the circulating virulent strains. As results, there was a high protection rate of 91.6% chickens against the virulent A/DK/VN/Bacninh/NCVD-17A384/2017 of the same clade and a cross-protection of 83.3% against A/duck/TG/NAVET(3)/2013 virus of clade 1.1. Our promising results showed that we can independently master the reverse genetics technology for generation of highly immunogenic vaccine candidates, and henceforth, it is a timely manner to reformulate avian influenza virus vaccines against variable H5 clade HPAI viruses in Vietnam.https://www.mdpi.com/2076-393X/8/2/159avian influenzaHPAIrecombinant strainreverse geneticsvaccine |
collection |
DOAJ |
language |
English |
format |
Article |
sources |
DOAJ |
author |
Hang Thi Thu Hoang Chi Hung Nguyen Ngan Thi Thuy Nguyen An Dang Pham Hang Thi Thu Nguyen Thanh Hoa Le Hanh Xuan Tran Ha Hoang Chu Nam Trung Nguyen |
spellingShingle |
Hang Thi Thu Hoang Chi Hung Nguyen Ngan Thi Thuy Nguyen An Dang Pham Hang Thi Thu Nguyen Thanh Hoa Le Hanh Xuan Tran Ha Hoang Chu Nam Trung Nguyen Immunization with the H5N1 Recombinant Vaccine Candidate Induces High Protection in Chickens against Vietnamese Highly Pathogenic Avian Influenza Virus Strains Vaccines avian influenza HPAI recombinant strain reverse genetics vaccine |
author_facet |
Hang Thi Thu Hoang Chi Hung Nguyen Ngan Thi Thuy Nguyen An Dang Pham Hang Thi Thu Nguyen Thanh Hoa Le Hanh Xuan Tran Ha Hoang Chu Nam Trung Nguyen |
author_sort |
Hang Thi Thu Hoang |
title |
Immunization with the H5N1 Recombinant Vaccine Candidate Induces High Protection in Chickens against Vietnamese Highly Pathogenic Avian Influenza Virus Strains |
title_short |
Immunization with the H5N1 Recombinant Vaccine Candidate Induces High Protection in Chickens against Vietnamese Highly Pathogenic Avian Influenza Virus Strains |
title_full |
Immunization with the H5N1 Recombinant Vaccine Candidate Induces High Protection in Chickens against Vietnamese Highly Pathogenic Avian Influenza Virus Strains |
title_fullStr |
Immunization with the H5N1 Recombinant Vaccine Candidate Induces High Protection in Chickens against Vietnamese Highly Pathogenic Avian Influenza Virus Strains |
title_full_unstemmed |
Immunization with the H5N1 Recombinant Vaccine Candidate Induces High Protection in Chickens against Vietnamese Highly Pathogenic Avian Influenza Virus Strains |
title_sort |
immunization with the h5n1 recombinant vaccine candidate induces high protection in chickens against vietnamese highly pathogenic avian influenza virus strains |
publisher |
MDPI AG |
series |
Vaccines |
issn |
2076-393X |
publishDate |
2020-04-01 |
description |
<b>Abstrac</b><b>t: </b>Vietnam is one of the countries most affected worldwide by the highly pathogenic avian influenza (HPAI) virus, which caused enormous economic loss and posed threats to public health. Over nearly two decades, with the antigenic changes in the diversified H5Ny viruses, the limited protective efficacy of the available vaccines was encountered. Therefore, it is necessary to approach a technology platform for the country to accelerate vaccine production that enables quick response to new influenza subtypes. This study utilized a powerful reverse genetics technique to successfully generate a recombinant H5N1 vaccine strain (designated as IBT-RG02) containing two surface proteins (haemagglutinin (HA) and neuraminidase (NA)) from the HPAI H5N1 (A/duck/Vietnam/HT2/2014(H5N1)) of the dominant clade 2.3.2.1c in Vietnam during 2012–2014. Importantly, the IBT-RG02 vaccine candidate has elicited high antibody titres in chickens (geometric mean titre (GMT) of 6.42 and 6.92, log<sub>2</sub> on day 14 and day 28 p.i., respectively). To test the efficacy, immunized chickens were challenged with the circulating virulent strains. As results, there was a high protection rate of 91.6% chickens against the virulent A/DK/VN/Bacninh/NCVD-17A384/2017 of the same clade and a cross-protection of 83.3% against A/duck/TG/NAVET(3)/2013 virus of clade 1.1. Our promising results showed that we can independently master the reverse genetics technology for generation of highly immunogenic vaccine candidates, and henceforth, it is a timely manner to reformulate avian influenza virus vaccines against variable H5 clade HPAI viruses in Vietnam. |
topic |
avian influenza HPAI recombinant strain reverse genetics vaccine |
url |
https://www.mdpi.com/2076-393X/8/2/159 |
work_keys_str_mv |
AT hangthithuhoang immunizationwiththeh5n1recombinantvaccinecandidateinduceshighprotectioninchickensagainstvietnamesehighlypathogenicavianinfluenzavirusstrains AT chihungnguyen immunizationwiththeh5n1recombinantvaccinecandidateinduceshighprotectioninchickensagainstvietnamesehighlypathogenicavianinfluenzavirusstrains AT nganthithuynguyen immunizationwiththeh5n1recombinantvaccinecandidateinduceshighprotectioninchickensagainstvietnamesehighlypathogenicavianinfluenzavirusstrains AT andangpham immunizationwiththeh5n1recombinantvaccinecandidateinduceshighprotectioninchickensagainstvietnamesehighlypathogenicavianinfluenzavirusstrains AT hangthithunguyen immunizationwiththeh5n1recombinantvaccinecandidateinduceshighprotectioninchickensagainstvietnamesehighlypathogenicavianinfluenzavirusstrains AT thanhhoale immunizationwiththeh5n1recombinantvaccinecandidateinduceshighprotectioninchickensagainstvietnamesehighlypathogenicavianinfluenzavirusstrains AT hanhxuantran immunizationwiththeh5n1recombinantvaccinecandidateinduceshighprotectioninchickensagainstvietnamesehighlypathogenicavianinfluenzavirusstrains AT hahoangchu immunizationwiththeh5n1recombinantvaccinecandidateinduceshighprotectioninchickensagainstvietnamesehighlypathogenicavianinfluenzavirusstrains AT namtrungnguyen immunizationwiththeh5n1recombinantvaccinecandidateinduceshighprotectioninchickensagainstvietnamesehighlypathogenicavianinfluenzavirusstrains |
_version_ |
1724917654703046656 |