A Constrained Sparse-Representation-Based Spatio-Temporal Anomaly Detector for Moving Targets in Hyperspectral Imagery Sequences

At present, small dim moving target detection in hyperspectral imagery sequences is mainly based on anomaly detection (AD). However, most conventional detection algorithms only utilize the spatial spectral information and rarely employ the temporal spectral information. Besides, multiple targets in...

Full description

Bibliographic Details
Published in:Remote Sensing
Main Authors: Zhaoxu Li, Qiang Ling, Jing Wu, Zhengyan Wang, Zaiping Lin
Format: Article
Language:English
Published: MDPI AG 2020-08-01
Subjects:
Online Access:https://www.mdpi.com/2072-4292/12/17/2783
_version_ 1849878027109924864
author Zhaoxu Li
Qiang Ling
Jing Wu
Zhengyan Wang
Zaiping Lin
author_facet Zhaoxu Li
Qiang Ling
Jing Wu
Zhengyan Wang
Zaiping Lin
author_sort Zhaoxu Li
collection DOAJ
container_title Remote Sensing
description At present, small dim moving target detection in hyperspectral imagery sequences is mainly based on anomaly detection (AD). However, most conventional detection algorithms only utilize the spatial spectral information and rarely employ the temporal spectral information. Besides, multiple targets in complex motion situations, such as multiple targets at different velocities and dense targets on the same trajectory, are still challenges for moving target detection. To address these problems, we propose a novel constrained sparse representation-based spatio-temporal anomaly detection algorithm that extends AD from the spatial domain to the spatio-temporal domain. Our algorithm includes a spatial detector and a temporal detector, which play different roles in moving target detection. The former can suppress moving background regions, and the latter can suppress non-homogeneous background and stationary objects. Two temporal background purification procedures maintain the effectiveness of the temporal detector for multiple targets in complex motion situations. Moreover, the smoothing and fusion of the spatial and temporal detection maps can adequately suppress background clutter and false alarms on the maps. Experiments conducted on a real dataset and a synthetic dataset show that the proposed algorithm can accurately detect multiple targets with different velocities and dense targets with the same trajectory and outperforms other state-of-the-art algorithms in high-noise scenarios.
format Article
id doaj-art-8a15f511f8d24eb88dcfd115e7cccd7e
institution Directory of Open Access Journals
issn 2072-4292
language English
publishDate 2020-08-01
publisher MDPI AG
record_format Article
spelling doaj-art-8a15f511f8d24eb88dcfd115e7cccd7e2025-08-20T01:10:54ZengMDPI AGRemote Sensing2072-42922020-08-011217278310.3390/rs12172783A Constrained Sparse-Representation-Based Spatio-Temporal Anomaly Detector for Moving Targets in Hyperspectral Imagery SequencesZhaoxu Li0Qiang Ling1Jing Wu2Zhengyan Wang3Zaiping Lin4College of Electronic Science and Technology, National University of Defense Technology, Changsha 410073, ChinaCollege of Electronic Science and Technology, National University of Defense Technology, Changsha 410073, ChinaCollege of Electronic Science and Technology, National University of Defense Technology, Changsha 410073, ChinaCollege of Electronic Science and Technology, National University of Defense Technology, Changsha 410073, ChinaCollege of Electronic Science and Technology, National University of Defense Technology, Changsha 410073, ChinaAt present, small dim moving target detection in hyperspectral imagery sequences is mainly based on anomaly detection (AD). However, most conventional detection algorithms only utilize the spatial spectral information and rarely employ the temporal spectral information. Besides, multiple targets in complex motion situations, such as multiple targets at different velocities and dense targets on the same trajectory, are still challenges for moving target detection. To address these problems, we propose a novel constrained sparse representation-based spatio-temporal anomaly detection algorithm that extends AD from the spatial domain to the spatio-temporal domain. Our algorithm includes a spatial detector and a temporal detector, which play different roles in moving target detection. The former can suppress moving background regions, and the latter can suppress non-homogeneous background and stationary objects. Two temporal background purification procedures maintain the effectiveness of the temporal detector for multiple targets in complex motion situations. Moreover, the smoothing and fusion of the spatial and temporal detection maps can adequately suppress background clutter and false alarms on the maps. Experiments conducted on a real dataset and a synthetic dataset show that the proposed algorithm can accurately detect multiple targets with different velocities and dense targets with the same trajectory and outperforms other state-of-the-art algorithms in high-noise scenarios.https://www.mdpi.com/2072-4292/12/17/2783anomaly detectionconstrained sparse representationhyperspectral imagerymoving target detectionspatio-temporal processing
spellingShingle Zhaoxu Li
Qiang Ling
Jing Wu
Zhengyan Wang
Zaiping Lin
A Constrained Sparse-Representation-Based Spatio-Temporal Anomaly Detector for Moving Targets in Hyperspectral Imagery Sequences
anomaly detection
constrained sparse representation
hyperspectral imagery
moving target detection
spatio-temporal processing
title A Constrained Sparse-Representation-Based Spatio-Temporal Anomaly Detector for Moving Targets in Hyperspectral Imagery Sequences
title_full A Constrained Sparse-Representation-Based Spatio-Temporal Anomaly Detector for Moving Targets in Hyperspectral Imagery Sequences
title_fullStr A Constrained Sparse-Representation-Based Spatio-Temporal Anomaly Detector for Moving Targets in Hyperspectral Imagery Sequences
title_full_unstemmed A Constrained Sparse-Representation-Based Spatio-Temporal Anomaly Detector for Moving Targets in Hyperspectral Imagery Sequences
title_short A Constrained Sparse-Representation-Based Spatio-Temporal Anomaly Detector for Moving Targets in Hyperspectral Imagery Sequences
title_sort constrained sparse representation based spatio temporal anomaly detector for moving targets in hyperspectral imagery sequences
topic anomaly detection
constrained sparse representation
hyperspectral imagery
moving target detection
spatio-temporal processing
url https://www.mdpi.com/2072-4292/12/17/2783
work_keys_str_mv AT zhaoxuli aconstrainedsparserepresentationbasedspatiotemporalanomalydetectorformovingtargetsinhyperspectralimagerysequences
AT qiangling aconstrainedsparserepresentationbasedspatiotemporalanomalydetectorformovingtargetsinhyperspectralimagerysequences
AT jingwu aconstrainedsparserepresentationbasedspatiotemporalanomalydetectorformovingtargetsinhyperspectralimagerysequences
AT zhengyanwang aconstrainedsparserepresentationbasedspatiotemporalanomalydetectorformovingtargetsinhyperspectralimagerysequences
AT zaipinglin aconstrainedsparserepresentationbasedspatiotemporalanomalydetectorformovingtargetsinhyperspectralimagerysequences
AT zhaoxuli constrainedsparserepresentationbasedspatiotemporalanomalydetectorformovingtargetsinhyperspectralimagerysequences
AT qiangling constrainedsparserepresentationbasedspatiotemporalanomalydetectorformovingtargetsinhyperspectralimagerysequences
AT jingwu constrainedsparserepresentationbasedspatiotemporalanomalydetectorformovingtargetsinhyperspectralimagerysequences
AT zhengyanwang constrainedsparserepresentationbasedspatiotemporalanomalydetectorformovingtargetsinhyperspectralimagerysequences
AT zaipinglin constrainedsparserepresentationbasedspatiotemporalanomalydetectorformovingtargetsinhyperspectralimagerysequences