A Constrained Sparse-Representation-Based Spatio-Temporal Anomaly Detector for Moving Targets in Hyperspectral Imagery Sequences
At present, small dim moving target detection in hyperspectral imagery sequences is mainly based on anomaly detection (AD). However, most conventional detection algorithms only utilize the spatial spectral information and rarely employ the temporal spectral information. Besides, multiple targets in...
| Published in: | Remote Sensing |
|---|---|
| Main Authors: | , , , , |
| Format: | Article |
| Language: | English |
| Published: |
MDPI AG
2020-08-01
|
| Subjects: | |
| Online Access: | https://www.mdpi.com/2072-4292/12/17/2783 |
| _version_ | 1849878027109924864 |
|---|---|
| author | Zhaoxu Li Qiang Ling Jing Wu Zhengyan Wang Zaiping Lin |
| author_facet | Zhaoxu Li Qiang Ling Jing Wu Zhengyan Wang Zaiping Lin |
| author_sort | Zhaoxu Li |
| collection | DOAJ |
| container_title | Remote Sensing |
| description | At present, small dim moving target detection in hyperspectral imagery sequences is mainly based on anomaly detection (AD). However, most conventional detection algorithms only utilize the spatial spectral information and rarely employ the temporal spectral information. Besides, multiple targets in complex motion situations, such as multiple targets at different velocities and dense targets on the same trajectory, are still challenges for moving target detection. To address these problems, we propose a novel constrained sparse representation-based spatio-temporal anomaly detection algorithm that extends AD from the spatial domain to the spatio-temporal domain. Our algorithm includes a spatial detector and a temporal detector, which play different roles in moving target detection. The former can suppress moving background regions, and the latter can suppress non-homogeneous background and stationary objects. Two temporal background purification procedures maintain the effectiveness of the temporal detector for multiple targets in complex motion situations. Moreover, the smoothing and fusion of the spatial and temporal detection maps can adequately suppress background clutter and false alarms on the maps. Experiments conducted on a real dataset and a synthetic dataset show that the proposed algorithm can accurately detect multiple targets with different velocities and dense targets with the same trajectory and outperforms other state-of-the-art algorithms in high-noise scenarios. |
| format | Article |
| id | doaj-art-8a15f511f8d24eb88dcfd115e7cccd7e |
| institution | Directory of Open Access Journals |
| issn | 2072-4292 |
| language | English |
| publishDate | 2020-08-01 |
| publisher | MDPI AG |
| record_format | Article |
| spelling | doaj-art-8a15f511f8d24eb88dcfd115e7cccd7e2025-08-20T01:10:54ZengMDPI AGRemote Sensing2072-42922020-08-011217278310.3390/rs12172783A Constrained Sparse-Representation-Based Spatio-Temporal Anomaly Detector for Moving Targets in Hyperspectral Imagery SequencesZhaoxu Li0Qiang Ling1Jing Wu2Zhengyan Wang3Zaiping Lin4College of Electronic Science and Technology, National University of Defense Technology, Changsha 410073, ChinaCollege of Electronic Science and Technology, National University of Defense Technology, Changsha 410073, ChinaCollege of Electronic Science and Technology, National University of Defense Technology, Changsha 410073, ChinaCollege of Electronic Science and Technology, National University of Defense Technology, Changsha 410073, ChinaCollege of Electronic Science and Technology, National University of Defense Technology, Changsha 410073, ChinaAt present, small dim moving target detection in hyperspectral imagery sequences is mainly based on anomaly detection (AD). However, most conventional detection algorithms only utilize the spatial spectral information and rarely employ the temporal spectral information. Besides, multiple targets in complex motion situations, such as multiple targets at different velocities and dense targets on the same trajectory, are still challenges for moving target detection. To address these problems, we propose a novel constrained sparse representation-based spatio-temporal anomaly detection algorithm that extends AD from the spatial domain to the spatio-temporal domain. Our algorithm includes a spatial detector and a temporal detector, which play different roles in moving target detection. The former can suppress moving background regions, and the latter can suppress non-homogeneous background and stationary objects. Two temporal background purification procedures maintain the effectiveness of the temporal detector for multiple targets in complex motion situations. Moreover, the smoothing and fusion of the spatial and temporal detection maps can adequately suppress background clutter and false alarms on the maps. Experiments conducted on a real dataset and a synthetic dataset show that the proposed algorithm can accurately detect multiple targets with different velocities and dense targets with the same trajectory and outperforms other state-of-the-art algorithms in high-noise scenarios.https://www.mdpi.com/2072-4292/12/17/2783anomaly detectionconstrained sparse representationhyperspectral imagerymoving target detectionspatio-temporal processing |
| spellingShingle | Zhaoxu Li Qiang Ling Jing Wu Zhengyan Wang Zaiping Lin A Constrained Sparse-Representation-Based Spatio-Temporal Anomaly Detector for Moving Targets in Hyperspectral Imagery Sequences anomaly detection constrained sparse representation hyperspectral imagery moving target detection spatio-temporal processing |
| title | A Constrained Sparse-Representation-Based Spatio-Temporal Anomaly Detector for Moving Targets in Hyperspectral Imagery Sequences |
| title_full | A Constrained Sparse-Representation-Based Spatio-Temporal Anomaly Detector for Moving Targets in Hyperspectral Imagery Sequences |
| title_fullStr | A Constrained Sparse-Representation-Based Spatio-Temporal Anomaly Detector for Moving Targets in Hyperspectral Imagery Sequences |
| title_full_unstemmed | A Constrained Sparse-Representation-Based Spatio-Temporal Anomaly Detector for Moving Targets in Hyperspectral Imagery Sequences |
| title_short | A Constrained Sparse-Representation-Based Spatio-Temporal Anomaly Detector for Moving Targets in Hyperspectral Imagery Sequences |
| title_sort | constrained sparse representation based spatio temporal anomaly detector for moving targets in hyperspectral imagery sequences |
| topic | anomaly detection constrained sparse representation hyperspectral imagery moving target detection spatio-temporal processing |
| url | https://www.mdpi.com/2072-4292/12/17/2783 |
| work_keys_str_mv | AT zhaoxuli aconstrainedsparserepresentationbasedspatiotemporalanomalydetectorformovingtargetsinhyperspectralimagerysequences AT qiangling aconstrainedsparserepresentationbasedspatiotemporalanomalydetectorformovingtargetsinhyperspectralimagerysequences AT jingwu aconstrainedsparserepresentationbasedspatiotemporalanomalydetectorformovingtargetsinhyperspectralimagerysequences AT zhengyanwang aconstrainedsparserepresentationbasedspatiotemporalanomalydetectorformovingtargetsinhyperspectralimagerysequences AT zaipinglin aconstrainedsparserepresentationbasedspatiotemporalanomalydetectorformovingtargetsinhyperspectralimagerysequences AT zhaoxuli constrainedsparserepresentationbasedspatiotemporalanomalydetectorformovingtargetsinhyperspectralimagerysequences AT qiangling constrainedsparserepresentationbasedspatiotemporalanomalydetectorformovingtargetsinhyperspectralimagerysequences AT jingwu constrainedsparserepresentationbasedspatiotemporalanomalydetectorformovingtargetsinhyperspectralimagerysequences AT zhengyanwang constrainedsparserepresentationbasedspatiotemporalanomalydetectorformovingtargetsinhyperspectralimagerysequences AT zaipinglin constrainedsparserepresentationbasedspatiotemporalanomalydetectorformovingtargetsinhyperspectralimagerysequences |
