Investigation of Molecular Changes in RAS/RAF/MEK/MAPK Pathway in Serous Adenocarcinomas and Serous Borderline Tumors of Ovary
Objectives:To investigate MAP Kinase (p38), c-Fos, c-Jun and c-Myc; in RAS/RAF/MEK/MAPK pathway by immunohistochemically in high grade serous adenocarcinomas, serous borderline tumors and benign lesions of the ovary.Materials and Methods:Twelve serous borderline tumors, 41 high-grade serous carcinom...
| Published in: | Ankara Üniversitesi Tıp Fakültesi Mecmuası |
|---|---|
| Main Author: | |
| Format: | Article |
| Language: | English |
| Published: |
Ankara University Press
2020-08-01
|
| Subjects: | |
| Online Access: |
http://ankaratipfakultesimecmuasi.net/archives/archive-detail/article-preview/nvestigation-of-molecular-changes-in-ras-raf-mek-m/39748
|
| _version_ | 1848651787474567168 |
|---|---|
| author | Cevriye Cansız Ersöz |
| author_facet | Cevriye Cansız Ersöz |
| author_sort | Cevriye Cansız Ersöz |
| collection | DOAJ |
| container_title | Ankara Üniversitesi Tıp Fakültesi Mecmuası |
| description | Objectives:To investigate MAP Kinase (p38), c-Fos, c-Jun and c-Myc; in RAS/RAF/MEK/MAPK pathway by immunohistochemically in high grade serous adenocarcinomas, serous borderline tumors and benign lesions of the ovary.Materials and Methods:Twelve serous borderline tumors, 41 high-grade serous carcinomas and 19 cases of serous papillary cystadenofibromas, serous cystadenomas; p38, c-Myc, c-Jun and c-Fos immunohistochemical staining were performed.Results:In borderline and benign lesions, diffuse and severe staining was observed in all cases with c-Fos, whereas focal and mild staining was observed in only 16 of the serous adenocarcinomas (p<0.05). While nuclear staining was not observed in any of the serous adenocarcinomas with c-Myc, mild and focal staining was detected in four of the borderline tumors and 16 of the benign tumors. There was a statistically significant difference in nuclear staining between the three groups (p<0.05). Nuclear staining was detected in four borderline tumors, in seven serous adenocarcinomas and in eight cases in the benign tumor group with c-Jun. These stainings were not statistically significant. Moderate staining was observed in 18 of benign tumors and in all borderline tumors and mild staining in eight of serous adenocarcinomas. A statistically significant difference was found between benign and serous borderline tumors and serous adenocarcinomas (p<0.05); there was no difference between benign tumors and borderline tumors.Conclusion:In borderline serous tumors; the nuclear expression of p38, c-Myc and c-Fos is statistically different from serous adenocarcinomas that proves the activation of the RAS/RAF/MEK/MAPK pathway in borderline tumors. In practical life, although it may seem usable in the cases that these tumors cannot be separated from serous adenocarcinoma; that we could not include in this study; the staining pattern in low-grade serous adenocarcinomas is unknown. Therefore, it should be investigated in large case series whether low grade serous adenocarcinomas and borderline tumors show similar expression patterns. |
| format | Article |
| id | doaj-dfc71e0bb55c461cbd19f8daf954eaad |
| institution | Directory of Open Access Journals |
| issn | 1307-5608 1307-5608 |
| language | English |
| publishDate | 2020-08-01 |
| publisher | Ankara University Press |
| record_format | Article |
| spelling | doaj-dfc71e0bb55c461cbd19f8daf954eaad2025-11-03T00:03:24ZengAnkara University PressAnkara Üniversitesi Tıp Fakültesi Mecmuası1307-56081307-56082020-08-0173214414810.4274/atfm.galenos.2020.1300713049054Investigation of Molecular Changes in RAS/RAF/MEK/MAPK Pathway in Serous Adenocarcinomas and Serous Borderline Tumors of OvaryCevriye Cansız Ersöz0 Ankara Üniversitesi Tıp Fakültesi, Tıbbi Patoloji Anabilim Dalı, Ankara, Türkiye Objectives:To investigate MAP Kinase (p38), c-Fos, c-Jun and c-Myc; in RAS/RAF/MEK/MAPK pathway by immunohistochemically in high grade serous adenocarcinomas, serous borderline tumors and benign lesions of the ovary.Materials and Methods:Twelve serous borderline tumors, 41 high-grade serous carcinomas and 19 cases of serous papillary cystadenofibromas, serous cystadenomas; p38, c-Myc, c-Jun and c-Fos immunohistochemical staining were performed.Results:In borderline and benign lesions, diffuse and severe staining was observed in all cases with c-Fos, whereas focal and mild staining was observed in only 16 of the serous adenocarcinomas (p<0.05). While nuclear staining was not observed in any of the serous adenocarcinomas with c-Myc, mild and focal staining was detected in four of the borderline tumors and 16 of the benign tumors. There was a statistically significant difference in nuclear staining between the three groups (p<0.05). Nuclear staining was detected in four borderline tumors, in seven serous adenocarcinomas and in eight cases in the benign tumor group with c-Jun. These stainings were not statistically significant. Moderate staining was observed in 18 of benign tumors and in all borderline tumors and mild staining in eight of serous adenocarcinomas. A statistically significant difference was found between benign and serous borderline tumors and serous adenocarcinomas (p<0.05); there was no difference between benign tumors and borderline tumors.Conclusion:In borderline serous tumors; the nuclear expression of p38, c-Myc and c-Fos is statistically different from serous adenocarcinomas that proves the activation of the RAS/RAF/MEK/MAPK pathway in borderline tumors. In practical life, although it may seem usable in the cases that these tumors cannot be separated from serous adenocarcinoma; that we could not include in this study; the staining pattern in low-grade serous adenocarcinomas is unknown. Therefore, it should be investigated in large case series whether low grade serous adenocarcinomas and borderline tumors show similar expression patterns. http://ankaratipfakultesimecmuasi.net/archives/archive-detail/article-preview/nvestigation-of-molecular-changes-in-ras-raf-mek-m/39748 ovaryserous tumorsras/raf/mek/mapk pathway |
| spellingShingle | Cevriye Cansız Ersöz Investigation of Molecular Changes in RAS/RAF/MEK/MAPK Pathway in Serous Adenocarcinomas and Serous Borderline Tumors of Ovary ovary serous tumors ras/raf/mek/mapk pathway |
| title | Investigation of Molecular Changes in RAS/RAF/MEK/MAPK Pathway in Serous Adenocarcinomas and Serous Borderline Tumors of Ovary |
| title_full | Investigation of Molecular Changes in RAS/RAF/MEK/MAPK Pathway in Serous Adenocarcinomas and Serous Borderline Tumors of Ovary |
| title_fullStr | Investigation of Molecular Changes in RAS/RAF/MEK/MAPK Pathway in Serous Adenocarcinomas and Serous Borderline Tumors of Ovary |
| title_full_unstemmed | Investigation of Molecular Changes in RAS/RAF/MEK/MAPK Pathway in Serous Adenocarcinomas and Serous Borderline Tumors of Ovary |
| title_short | Investigation of Molecular Changes in RAS/RAF/MEK/MAPK Pathway in Serous Adenocarcinomas and Serous Borderline Tumors of Ovary |
| title_sort | investigation of molecular changes in ras raf mek mapk pathway in serous adenocarcinomas and serous borderline tumors of ovary |
| topic | ovary serous tumors ras/raf/mek/mapk pathway |
| url |
http://ankaratipfakultesimecmuasi.net/archives/archive-detail/article-preview/nvestigation-of-molecular-changes-in-ras-raf-mek-m/39748
|
| work_keys_str_mv | AT cevriyecansızersoz investigationofmolecularchangesinrasrafmekmapkpathwayinserousadenocarcinomasandserousborderlinetumorsofovary |
