Obesity Reshapes Visceral Fat-Derived MHC I Associated-Immunopeptidomes and Generates Antigenic Peptides to Drive CD8+ T Cell Responses
Summary: Adaptive CD8+ T cells were observed to contribute to the initiation and progression of obesity-induced visceral adipose tissue (VAT) chronic inflammation that is critically linked to metabolic disorders. Numerous peptides presented by the major histocompatibility complex (MHC) class I molec...
Main Authors: | , , , , , , , , , |
---|---|
Format: | Article |
Language: | English |
Published: |
Elsevier
2020-04-01
|
Series: | iScience |
Online Access: | http://www.sciencedirect.com/science/article/pii/S2589004220301619 |
id |
doaj-6881860054da4f9d9e31a921ef36cb2c |
---|---|
record_format |
Article |
spelling |
doaj-6881860054da4f9d9e31a921ef36cb2c2020-11-25T03:03:23ZengElsevieriScience2589-00422020-04-01234Obesity Reshapes Visceral Fat-Derived MHC I Associated-Immunopeptidomes and Generates Antigenic Peptides to Drive CD8+ T Cell ResponsesXiaoling Chen0Shufeng Wang1Yi Huang2Xia Zhao3Xu Jia4Gang Meng5Qian Zheng6Mengjun Zhang7Yuzhang Wu8Li Wang9Institute of Immunology PLA, Army Medical University (Third Military Medical University), Chongqing 400038, ChinaInstitute of Immunology PLA, Army Medical University (Third Military Medical University), Chongqing 400038, ChinaBiomedical Analysis Center, Army Medical University (Third Military Medical University), Chongqing 400038, ChinaBioinformatics Center, Department of Microbiology, Army Medical University (Third Military Medical University), Chongqing 400038, ChinaInstitute of Immunology PLA, Army Medical University (Third Military Medical University), Chongqing 400038, China; Department of Physiology, North Sichuan Medical College, Nanchong 637007, ChinaDepartment of Pathology, Southwest Hospital, Army Medical University (Third Military Medical University), Chongqing 400038, ChinaDepartment of Physiology, North Sichuan Medical College, Nanchong 637007, ChinaDepartment of Pharmaceutical Analysis, College of Pharmacy, Army Medical University (Third Military Medical University), Chongqing 400038, ChinaInstitute of Immunology PLA, Army Medical University (Third Military Medical University), Chongqing 400038, China; Corresponding authorInstitute of Immunology PLA, Army Medical University (Third Military Medical University), Chongqing 400038, China; Corresponding authorSummary: Adaptive CD8+ T cells were observed to contribute to the initiation and progression of obesity-induced visceral adipose tissue (VAT) chronic inflammation that is critically linked to metabolic disorders. Numerous peptides presented by the major histocompatibility complex (MHC) class I molecules at the cell surface are collectively termed as MHC I-associated immunopeptidome (MIP) for the interaction with CD8+ T cells. We conducted the in-depth mapping of MIP of VAT from lean and obese mice using large-scale high-resolution mass spectrometry and observed that obesity significantly alters the landscape of VAT MIPs. Additionally, the obese VAT-exclusive MIP source proteome reflected a distinct obesity-associated signature. A peptide derived from lactate dehydrogenase A (LDHA) or B chain, named LDHA237-244, was identified as an obese VAT-exclusive immunogenic peptide that was capable of eliciting pro-inflammatory CD8+ T cells responses. Our findings suggest that certain immunogenic peptides generated by obesity may trigger CD8+ T cell-mediated VAT inflammation. : Diabetology; Immunology; Proteomics Subject Areas: Diabetology, Immunology, Proteomicshttp://www.sciencedirect.com/science/article/pii/S2589004220301619 |
collection |
DOAJ |
language |
English |
format |
Article |
sources |
DOAJ |
author |
Xiaoling Chen Shufeng Wang Yi Huang Xia Zhao Xu Jia Gang Meng Qian Zheng Mengjun Zhang Yuzhang Wu Li Wang |
spellingShingle |
Xiaoling Chen Shufeng Wang Yi Huang Xia Zhao Xu Jia Gang Meng Qian Zheng Mengjun Zhang Yuzhang Wu Li Wang Obesity Reshapes Visceral Fat-Derived MHC I Associated-Immunopeptidomes and Generates Antigenic Peptides to Drive CD8+ T Cell Responses iScience |
author_facet |
Xiaoling Chen Shufeng Wang Yi Huang Xia Zhao Xu Jia Gang Meng Qian Zheng Mengjun Zhang Yuzhang Wu Li Wang |
author_sort |
Xiaoling Chen |
title |
Obesity Reshapes Visceral Fat-Derived MHC I Associated-Immunopeptidomes and Generates Antigenic Peptides to Drive CD8+ T Cell Responses |
title_short |
Obesity Reshapes Visceral Fat-Derived MHC I Associated-Immunopeptidomes and Generates Antigenic Peptides to Drive CD8+ T Cell Responses |
title_full |
Obesity Reshapes Visceral Fat-Derived MHC I Associated-Immunopeptidomes and Generates Antigenic Peptides to Drive CD8+ T Cell Responses |
title_fullStr |
Obesity Reshapes Visceral Fat-Derived MHC I Associated-Immunopeptidomes and Generates Antigenic Peptides to Drive CD8+ T Cell Responses |
title_full_unstemmed |
Obesity Reshapes Visceral Fat-Derived MHC I Associated-Immunopeptidomes and Generates Antigenic Peptides to Drive CD8+ T Cell Responses |
title_sort |
obesity reshapes visceral fat-derived mhc i associated-immunopeptidomes and generates antigenic peptides to drive cd8+ t cell responses |
publisher |
Elsevier |
series |
iScience |
issn |
2589-0042 |
publishDate |
2020-04-01 |
description |
Summary: Adaptive CD8+ T cells were observed to contribute to the initiation and progression of obesity-induced visceral adipose tissue (VAT) chronic inflammation that is critically linked to metabolic disorders. Numerous peptides presented by the major histocompatibility complex (MHC) class I molecules at the cell surface are collectively termed as MHC I-associated immunopeptidome (MIP) for the interaction with CD8+ T cells. We conducted the in-depth mapping of MIP of VAT from lean and obese mice using large-scale high-resolution mass spectrometry and observed that obesity significantly alters the landscape of VAT MIPs. Additionally, the obese VAT-exclusive MIP source proteome reflected a distinct obesity-associated signature. A peptide derived from lactate dehydrogenase A (LDHA) or B chain, named LDHA237-244, was identified as an obese VAT-exclusive immunogenic peptide that was capable of eliciting pro-inflammatory CD8+ T cells responses. Our findings suggest that certain immunogenic peptides generated by obesity may trigger CD8+ T cell-mediated VAT inflammation. : Diabetology; Immunology; Proteomics Subject Areas: Diabetology, Immunology, Proteomics |
url |
http://www.sciencedirect.com/science/article/pii/S2589004220301619 |
work_keys_str_mv |
AT xiaolingchen obesityreshapesvisceralfatderivedmhciassociatedimmunopeptidomesandgeneratesantigenicpeptidestodrivecd8tcellresponses AT shufengwang obesityreshapesvisceralfatderivedmhciassociatedimmunopeptidomesandgeneratesantigenicpeptidestodrivecd8tcellresponses AT yihuang obesityreshapesvisceralfatderivedmhciassociatedimmunopeptidomesandgeneratesantigenicpeptidestodrivecd8tcellresponses AT xiazhao obesityreshapesvisceralfatderivedmhciassociatedimmunopeptidomesandgeneratesantigenicpeptidestodrivecd8tcellresponses AT xujia obesityreshapesvisceralfatderivedmhciassociatedimmunopeptidomesandgeneratesantigenicpeptidestodrivecd8tcellresponses AT gangmeng obesityreshapesvisceralfatderivedmhciassociatedimmunopeptidomesandgeneratesantigenicpeptidestodrivecd8tcellresponses AT qianzheng obesityreshapesvisceralfatderivedmhciassociatedimmunopeptidomesandgeneratesantigenicpeptidestodrivecd8tcellresponses AT mengjunzhang obesityreshapesvisceralfatderivedmhciassociatedimmunopeptidomesandgeneratesantigenicpeptidestodrivecd8tcellresponses AT yuzhangwu obesityreshapesvisceralfatderivedmhciassociatedimmunopeptidomesandgeneratesantigenicpeptidestodrivecd8tcellresponses AT liwang obesityreshapesvisceralfatderivedmhciassociatedimmunopeptidomesandgeneratesantigenicpeptidestodrivecd8tcellresponses |
_version_ |
1724685963064508416 |