Effects of Muscarinic Acetylcholine 3 Receptor208-227 Peptide Immunization on Autoimmune Response in Nonobese Diabetic Mice

The second extracellular loop (LFWQYFVGKRTVPPGECFIQFLSEPTITFGTAI, aa 205–237) of muscarinic acetylcholine 3 receptor (M3R) has been reported to be an epitope for autoantibodies generated during certain autoimmune disorders, including Sjögren’s syndrome (SS). Autoantibodies against M3R228–237 have be...

Full description

Bibliographic Details

Published in:	Clinical and Developmental Immunology
Main Authors:	Lin Yang, Jinzhe Ju, Wei Zhang, Fengfeng Lv, Chunyan Pang, Guoan Yang, Yongfu Wang
Format:	Article
Language:	English
Published:	Wiley 2013-01-01
Online Access:	http://dx.doi.org/10.1155/2013/485213