Deleterious Impact of a Novel CFH Splice Site Variant in Atypical Hemolytic Uremic Syndrome
Atypical hemolytic uremic syndrome (aHUS) is a heterogeneous disorder characterized by microangiopathic hemolytic anemia (MAHA), thrombocytopenia, and acute kidney injury (AKI). In about 50% of cases, pathogenic variants in genes involved in the innate immune response including complement factors co...
Main Authors: | , , , , , |
---|---|
Format: | Article |
Language: | English |
Published: |
Frontiers Media S.A.
2019-05-01
|
Series: | Frontiers in Genetics |
Subjects: | |
Online Access: | https://www.frontiersin.org/article/10.3389/fgene.2019.00465/full |
id |
doaj-01f4ae2fa657441da1db05c8ff1ee1f5 |
---|---|
record_format |
Article |
spelling |
doaj-01f4ae2fa657441da1db05c8ff1ee1f52020-11-24T22:19:08ZengFrontiers Media S.A.Frontiers in Genetics1664-80212019-05-011010.3389/fgene.2019.00465457825Deleterious Impact of a Novel CFH Splice Site Variant in Atypical Hemolytic Uremic SyndromeRia Schönauer0Anna Seidel1Maik Grohmann2Tom H. Lindner3Carsten Bergmann4Jan Halbritter5Division of Nephrology, University Hospital Leipzig, Leipzig, GermanyDivision of Nephrology, University Hospital Leipzig, Leipzig, GermanyCenter for Human Genetics, Bioscientia, Ingelheim, GermanyDivision of Nephrology, University Hospital Leipzig, Leipzig, GermanyCenter for Human Genetics, Bioscientia, Ingelheim, GermanyDivision of Nephrology, University Hospital Leipzig, Leipzig, GermanyAtypical hemolytic uremic syndrome (aHUS) is a heterogeneous disorder characterized by microangiopathic hemolytic anemia (MAHA), thrombocytopenia, and acute kidney injury (AKI). In about 50% of cases, pathogenic variants in genes involved in the innate immune response including complement factors complement factor H (CFH), CFI, CFB, C3, and membrane co-factor protein (MCP/CD46) put patients at risk for uncontrolled activation of the alternative complement pathway. As aHUS is characterized by incomplete penetrance and presence of additional triggers for disease manifestation, genetic variant interpretation is challenging and streamlined functional variant evaluation is urgently needed. Here, we report the case of a 27-year-old female without previous medical and family history who presented with confusion, petechial bleeding, and anuric AKI. Kidney biopsy revealed glomerular thrombotic microangiopathy (TMA). Targeted next generation sequencing identified a paternally transmitted novel heterozygous splice site variant in the CFH gene [c.3134-2A>G; p.Asp1045_Thr1053del] which resulted in a partial in-frame deletion of exon 20 transcript as determined by cDNA analysis. On the protein level, the concomitant loss of 9 amino acids in the short consensus repeat (SCR) domains 17 and 18 of CFH includes a highly conserved cysteine residue, which is assumed to be essential for proper structural folding and protein function. Treatment with steroids, plasmapheresis, and the complement inhibitor eculizumab led to complete hematological and clinical remission after several months and stable renal function up to 6 years later. In conclusion, genetic investigation for pathogenic variants and evaluation of their functional impact, in particular in the case of splice site variants, is clinically relevant and enables not only better molecular understanding but helps to guide therapy with complement inhibitors.https://www.frontiersin.org/article/10.3389/fgene.2019.00465/fullcomplement factor Hatypical hemolytic uremic syndromesplice site variantshort consensus repeat 18eculizumabCFH |
collection |
DOAJ |
language |
English |
format |
Article |
sources |
DOAJ |
author |
Ria Schönauer Anna Seidel Maik Grohmann Tom H. Lindner Carsten Bergmann Jan Halbritter |
spellingShingle |
Ria Schönauer Anna Seidel Maik Grohmann Tom H. Lindner Carsten Bergmann Jan Halbritter Deleterious Impact of a Novel CFH Splice Site Variant in Atypical Hemolytic Uremic Syndrome Frontiers in Genetics complement factor H atypical hemolytic uremic syndrome splice site variant short consensus repeat 18 eculizumab CFH |
author_facet |
Ria Schönauer Anna Seidel Maik Grohmann Tom H. Lindner Carsten Bergmann Jan Halbritter |
author_sort |
Ria Schönauer |
title |
Deleterious Impact of a Novel CFH Splice Site Variant in Atypical Hemolytic Uremic Syndrome |
title_short |
Deleterious Impact of a Novel CFH Splice Site Variant in Atypical Hemolytic Uremic Syndrome |
title_full |
Deleterious Impact of a Novel CFH Splice Site Variant in Atypical Hemolytic Uremic Syndrome |
title_fullStr |
Deleterious Impact of a Novel CFH Splice Site Variant in Atypical Hemolytic Uremic Syndrome |
title_full_unstemmed |
Deleterious Impact of a Novel CFH Splice Site Variant in Atypical Hemolytic Uremic Syndrome |
title_sort |
deleterious impact of a novel cfh splice site variant in atypical hemolytic uremic syndrome |
publisher |
Frontiers Media S.A. |
series |
Frontiers in Genetics |
issn |
1664-8021 |
publishDate |
2019-05-01 |
description |
Atypical hemolytic uremic syndrome (aHUS) is a heterogeneous disorder characterized by microangiopathic hemolytic anemia (MAHA), thrombocytopenia, and acute kidney injury (AKI). In about 50% of cases, pathogenic variants in genes involved in the innate immune response including complement factors complement factor H (CFH), CFI, CFB, C3, and membrane co-factor protein (MCP/CD46) put patients at risk for uncontrolled activation of the alternative complement pathway. As aHUS is characterized by incomplete penetrance and presence of additional triggers for disease manifestation, genetic variant interpretation is challenging and streamlined functional variant evaluation is urgently needed. Here, we report the case of a 27-year-old female without previous medical and family history who presented with confusion, petechial bleeding, and anuric AKI. Kidney biopsy revealed glomerular thrombotic microangiopathy (TMA). Targeted next generation sequencing identified a paternally transmitted novel heterozygous splice site variant in the CFH gene [c.3134-2A>G; p.Asp1045_Thr1053del] which resulted in a partial in-frame deletion of exon 20 transcript as determined by cDNA analysis. On the protein level, the concomitant loss of 9 amino acids in the short consensus repeat (SCR) domains 17 and 18 of CFH includes a highly conserved cysteine residue, which is assumed to be essential for proper structural folding and protein function. Treatment with steroids, plasmapheresis, and the complement inhibitor eculizumab led to complete hematological and clinical remission after several months and stable renal function up to 6 years later. In conclusion, genetic investigation for pathogenic variants and evaluation of their functional impact, in particular in the case of splice site variants, is clinically relevant and enables not only better molecular understanding but helps to guide therapy with complement inhibitors. |
topic |
complement factor H atypical hemolytic uremic syndrome splice site variant short consensus repeat 18 eculizumab CFH |
url |
https://www.frontiersin.org/article/10.3389/fgene.2019.00465/full |
work_keys_str_mv |
AT riaschonauer deleteriousimpactofanovelcfhsplicesitevariantinatypicalhemolyticuremicsyndrome AT annaseidel deleteriousimpactofanovelcfhsplicesitevariantinatypicalhemolyticuremicsyndrome AT maikgrohmann deleteriousimpactofanovelcfhsplicesitevariantinatypicalhemolyticuremicsyndrome AT tomhlindner deleteriousimpactofanovelcfhsplicesitevariantinatypicalhemolyticuremicsyndrome AT carstenbergmann deleteriousimpactofanovelcfhsplicesitevariantinatypicalhemolyticuremicsyndrome AT janhalbritter deleteriousimpactofanovelcfhsplicesitevariantinatypicalhemolyticuremicsyndrome |
_version_ |
1725779927419060224 |