17DD and 17D-213/77 yellow fever substrains trigger a balanced cytokine profile in primary vaccinated children.
BACKGROUND: This study aimed to compare the cytokine-mediated immune response in children submitted to primary vaccination with the YF-17D-213/77 or YF-17DD yellow fever (YF) substrains. METHODS: A non-probabilistic sample of eighty healthy primary vaccinated (PV) children was selected on the basis...
Main Authors: | , , , , , , , , , , , , , , , , , , , , |
---|---|
Format: | Article |
Language: | English |
Published: |
Public Library of Science (PLoS)
2012-01-01
|
Series: | PLoS ONE |
Online Access: | http://europepmc.org/articles/PMC3519464?pdf=render |
id |
doaj-1bfd8764f974455ea03eded87ffe23d7 |
---|---|
record_format |
Article |
spelling |
doaj-1bfd8764f974455ea03eded87ffe23d72020-11-25T01:46:40ZengPublic Library of Science (PLoS)PLoS ONE1932-62032012-01-01712e4982810.1371/journal.pone.004982817DD and 17D-213/77 yellow fever substrains trigger a balanced cytokine profile in primary vaccinated children.Ana Carolina Campi-AzevedoLuiza Pacheco de Araújo-PortoMaria Luiza-SilvaMaurício Azevedo BatistaMarina Angela MartinsRenato Sathler-AvelarDenise da Silveira-LemosLuiz Antonio Bastos CamachoReinaldo de Menezes MartinsMaria de Lourdes de Sousa MaiaRoberto Henrique Guedes FariasMarcos da Silva FreireRicardo GallerAkira HommaJosé Geraldo Leite RibeiroJandira Aparecida Campos LemosMaria Auxiliadora-MartinsIramaya Rodrigues CaldasSilvana Maria Elói-SantosAndréa Teixeira-CarvalhoOlindo Assis Martins-FilhoBACKGROUND: This study aimed to compare the cytokine-mediated immune response in children submitted to primary vaccination with the YF-17D-213/77 or YF-17DD yellow fever (YF) substrains. METHODS: A non-probabilistic sample of eighty healthy primary vaccinated (PV) children was selected on the basis of their previously known humoral immune response to the YF vaccines. The selected children were categorized according to their YF-neutralizing antibody titers (PRNT) and referred to as seroconverters (PV-PRNT(+)) or nonseroconverters (PV-PRNT(-)). Following revaccination with the YF-17DD, the PV-PRNT(-) children (YF-17D-213/77 and YF-17DD groups) seroconverted and were referred as RV-PRNT(+). The cytokine-mediated immune response was investigated after short-term in vitro cultures of whole blood samples. The results are expressed as frequency of high cytokine producers, taking the global median of the cytokine index (YF-Ag/control) as the cut-off. RESULTS: The YF-17D-213/77 and the YF-17DD substrains triggered a balanced overall inflammatory/regulatory cytokine pattern in PV-PRNT(+), with a slight predominance of IL-12 in YF-17DD vaccinees and a modest prevalence of IL-10 in YF-17D-213/77. Prominent frequency of neutrophil-derived TNF-α and neutrophils and monocyte-producing IL-12 were the major features of PV-PRNT(+) in the YF-17DD, whereas relevant inflammatory response, mediated by IL-12(+)CD8(+) T cells, was the hallmark of the YF-17D-213/77 vaccinees. Both substrains were able to elicit particular but relevant inflammatory events, regardless of the anti-YF PRNT antibody levels. PV-PRNT(-) children belonging to the YF-17DD arm presented gaps in the inflammatory cytokine signature, especially in terms of the innate immunity, whereas in the YF-17D-213/77 arm the most relevant gap was the deficiency of IL-12-producing CD8(+)T cells. Revaccination with YF-17DD prompted a balanced cytokine profile in YF-17DD nonresponders and a robust inflammatory profile in YF-17D-213/77 nonresponders. CONCLUSION: Our findings demonstrated that, just like the YF-17DD reference vaccine, the YF-17D-213/77 seed lot induced a mixed pattern of inflammatory and regulatory cytokines, supporting its universal use for immunization.http://europepmc.org/articles/PMC3519464?pdf=render |
collection |
DOAJ |
language |
English |
format |
Article |
sources |
DOAJ |
author |
Ana Carolina Campi-Azevedo Luiza Pacheco de Araújo-Porto Maria Luiza-Silva Maurício Azevedo Batista Marina Angela Martins Renato Sathler-Avelar Denise da Silveira-Lemos Luiz Antonio Bastos Camacho Reinaldo de Menezes Martins Maria de Lourdes de Sousa Maia Roberto Henrique Guedes Farias Marcos da Silva Freire Ricardo Galler Akira Homma José Geraldo Leite Ribeiro Jandira Aparecida Campos Lemos Maria Auxiliadora-Martins Iramaya Rodrigues Caldas Silvana Maria Elói-Santos Andréa Teixeira-Carvalho Olindo Assis Martins-Filho |
spellingShingle |
Ana Carolina Campi-Azevedo Luiza Pacheco de Araújo-Porto Maria Luiza-Silva Maurício Azevedo Batista Marina Angela Martins Renato Sathler-Avelar Denise da Silveira-Lemos Luiz Antonio Bastos Camacho Reinaldo de Menezes Martins Maria de Lourdes de Sousa Maia Roberto Henrique Guedes Farias Marcos da Silva Freire Ricardo Galler Akira Homma José Geraldo Leite Ribeiro Jandira Aparecida Campos Lemos Maria Auxiliadora-Martins Iramaya Rodrigues Caldas Silvana Maria Elói-Santos Andréa Teixeira-Carvalho Olindo Assis Martins-Filho 17DD and 17D-213/77 yellow fever substrains trigger a balanced cytokine profile in primary vaccinated children. PLoS ONE |
author_facet |
Ana Carolina Campi-Azevedo Luiza Pacheco de Araújo-Porto Maria Luiza-Silva Maurício Azevedo Batista Marina Angela Martins Renato Sathler-Avelar Denise da Silveira-Lemos Luiz Antonio Bastos Camacho Reinaldo de Menezes Martins Maria de Lourdes de Sousa Maia Roberto Henrique Guedes Farias Marcos da Silva Freire Ricardo Galler Akira Homma José Geraldo Leite Ribeiro Jandira Aparecida Campos Lemos Maria Auxiliadora-Martins Iramaya Rodrigues Caldas Silvana Maria Elói-Santos Andréa Teixeira-Carvalho Olindo Assis Martins-Filho |
author_sort |
Ana Carolina Campi-Azevedo |
title |
17DD and 17D-213/77 yellow fever substrains trigger a balanced cytokine profile in primary vaccinated children. |
title_short |
17DD and 17D-213/77 yellow fever substrains trigger a balanced cytokine profile in primary vaccinated children. |
title_full |
17DD and 17D-213/77 yellow fever substrains trigger a balanced cytokine profile in primary vaccinated children. |
title_fullStr |
17DD and 17D-213/77 yellow fever substrains trigger a balanced cytokine profile in primary vaccinated children. |
title_full_unstemmed |
17DD and 17D-213/77 yellow fever substrains trigger a balanced cytokine profile in primary vaccinated children. |
title_sort |
17dd and 17d-213/77 yellow fever substrains trigger a balanced cytokine profile in primary vaccinated children. |
publisher |
Public Library of Science (PLoS) |
series |
PLoS ONE |
issn |
1932-6203 |
publishDate |
2012-01-01 |
description |
BACKGROUND: This study aimed to compare the cytokine-mediated immune response in children submitted to primary vaccination with the YF-17D-213/77 or YF-17DD yellow fever (YF) substrains. METHODS: A non-probabilistic sample of eighty healthy primary vaccinated (PV) children was selected on the basis of their previously known humoral immune response to the YF vaccines. The selected children were categorized according to their YF-neutralizing antibody titers (PRNT) and referred to as seroconverters (PV-PRNT(+)) or nonseroconverters (PV-PRNT(-)). Following revaccination with the YF-17DD, the PV-PRNT(-) children (YF-17D-213/77 and YF-17DD groups) seroconverted and were referred as RV-PRNT(+). The cytokine-mediated immune response was investigated after short-term in vitro cultures of whole blood samples. The results are expressed as frequency of high cytokine producers, taking the global median of the cytokine index (YF-Ag/control) as the cut-off. RESULTS: The YF-17D-213/77 and the YF-17DD substrains triggered a balanced overall inflammatory/regulatory cytokine pattern in PV-PRNT(+), with a slight predominance of IL-12 in YF-17DD vaccinees and a modest prevalence of IL-10 in YF-17D-213/77. Prominent frequency of neutrophil-derived TNF-α and neutrophils and monocyte-producing IL-12 were the major features of PV-PRNT(+) in the YF-17DD, whereas relevant inflammatory response, mediated by IL-12(+)CD8(+) T cells, was the hallmark of the YF-17D-213/77 vaccinees. Both substrains were able to elicit particular but relevant inflammatory events, regardless of the anti-YF PRNT antibody levels. PV-PRNT(-) children belonging to the YF-17DD arm presented gaps in the inflammatory cytokine signature, especially in terms of the innate immunity, whereas in the YF-17D-213/77 arm the most relevant gap was the deficiency of IL-12-producing CD8(+)T cells. Revaccination with YF-17DD prompted a balanced cytokine profile in YF-17DD nonresponders and a robust inflammatory profile in YF-17D-213/77 nonresponders. CONCLUSION: Our findings demonstrated that, just like the YF-17DD reference vaccine, the YF-17D-213/77 seed lot induced a mixed pattern of inflammatory and regulatory cytokines, supporting its universal use for immunization. |
url |
http://europepmc.org/articles/PMC3519464?pdf=render |
work_keys_str_mv |
AT anacarolinacampiazevedo 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren AT luizapachecodearaujoporto 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren AT marialuizasilva 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren AT mauricioazevedobatista 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren AT marinaangelamartins 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren AT renatosathleravelar 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren AT denisedasilveiralemos 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren AT luizantoniobastoscamacho 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren AT reinaldodemenezesmartins 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren AT mariadelourdesdesousamaia 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren AT robertohenriqueguedesfarias 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren AT marcosdasilvafreire 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren AT ricardogaller 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren AT akirahomma 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren AT josegeraldoleiteribeiro 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren AT jandiraaparecidacamposlemos 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren AT mariaauxiliadoramartins 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren AT iramayarodriguescaldas 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren AT silvanamariaeloisantos 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren AT andreateixeiracarvalho 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren AT olindoassismartinsfilho 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren |
_version_ |
1725017961942482944 |