17DD and 17D-213/77 yellow fever substrains trigger a balanced cytokine profile in primary vaccinated children.

BACKGROUND: This study aimed to compare the cytokine-mediated immune response in children submitted to primary vaccination with the YF-17D-213/77 or YF-17DD yellow fever (YF) substrains. METHODS: A non-probabilistic sample of eighty healthy primary vaccinated (PV) children was selected on the basis...

Full description

Bibliographic Details
Main Authors: Ana Carolina Campi-Azevedo, Luiza Pacheco de Araújo-Porto, Maria Luiza-Silva, Maurício Azevedo Batista, Marina Angela Martins, Renato Sathler-Avelar, Denise da Silveira-Lemos, Luiz Antonio Bastos Camacho, Reinaldo de Menezes Martins, Maria de Lourdes de Sousa Maia, Roberto Henrique Guedes Farias, Marcos da Silva Freire, Ricardo Galler, Akira Homma, José Geraldo Leite Ribeiro, Jandira Aparecida Campos Lemos, Maria Auxiliadora-Martins, Iramaya Rodrigues Caldas, Silvana Maria Elói-Santos, Andréa Teixeira-Carvalho, Olindo Assis Martins-Filho
Format: Article
Language:English
Published: Public Library of Science (PLoS) 2012-01-01
Series:PLoS ONE
Online Access:http://europepmc.org/articles/PMC3519464?pdf=render
id doaj-1bfd8764f974455ea03eded87ffe23d7
record_format Article
spelling doaj-1bfd8764f974455ea03eded87ffe23d72020-11-25T01:46:40ZengPublic Library of Science (PLoS)PLoS ONE1932-62032012-01-01712e4982810.1371/journal.pone.004982817DD and 17D-213/77 yellow fever substrains trigger a balanced cytokine profile in primary vaccinated children.Ana Carolina Campi-AzevedoLuiza Pacheco de Araújo-PortoMaria Luiza-SilvaMaurício Azevedo BatistaMarina Angela MartinsRenato Sathler-AvelarDenise da Silveira-LemosLuiz Antonio Bastos CamachoReinaldo de Menezes MartinsMaria de Lourdes de Sousa MaiaRoberto Henrique Guedes FariasMarcos da Silva FreireRicardo GallerAkira HommaJosé Geraldo Leite RibeiroJandira Aparecida Campos LemosMaria Auxiliadora-MartinsIramaya Rodrigues CaldasSilvana Maria Elói-SantosAndréa Teixeira-CarvalhoOlindo Assis Martins-FilhoBACKGROUND: This study aimed to compare the cytokine-mediated immune response in children submitted to primary vaccination with the YF-17D-213/77 or YF-17DD yellow fever (YF) substrains. METHODS: A non-probabilistic sample of eighty healthy primary vaccinated (PV) children was selected on the basis of their previously known humoral immune response to the YF vaccines. The selected children were categorized according to their YF-neutralizing antibody titers (PRNT) and referred to as seroconverters (PV-PRNT(+)) or nonseroconverters (PV-PRNT(-)). Following revaccination with the YF-17DD, the PV-PRNT(-) children (YF-17D-213/77 and YF-17DD groups) seroconverted and were referred as RV-PRNT(+). The cytokine-mediated immune response was investigated after short-term in vitro cultures of whole blood samples. The results are expressed as frequency of high cytokine producers, taking the global median of the cytokine index (YF-Ag/control) as the cut-off. RESULTS: The YF-17D-213/77 and the YF-17DD substrains triggered a balanced overall inflammatory/regulatory cytokine pattern in PV-PRNT(+), with a slight predominance of IL-12 in YF-17DD vaccinees and a modest prevalence of IL-10 in YF-17D-213/77. Prominent frequency of neutrophil-derived TNF-α and neutrophils and monocyte-producing IL-12 were the major features of PV-PRNT(+) in the YF-17DD, whereas relevant inflammatory response, mediated by IL-12(+)CD8(+) T cells, was the hallmark of the YF-17D-213/77 vaccinees. Both substrains were able to elicit particular but relevant inflammatory events, regardless of the anti-YF PRNT antibody levels. PV-PRNT(-) children belonging to the YF-17DD arm presented gaps in the inflammatory cytokine signature, especially in terms of the innate immunity, whereas in the YF-17D-213/77 arm the most relevant gap was the deficiency of IL-12-producing CD8(+)T cells. Revaccination with YF-17DD prompted a balanced cytokine profile in YF-17DD nonresponders and a robust inflammatory profile in YF-17D-213/77 nonresponders. CONCLUSION: Our findings demonstrated that, just like the YF-17DD reference vaccine, the YF-17D-213/77 seed lot induced a mixed pattern of inflammatory and regulatory cytokines, supporting its universal use for immunization.http://europepmc.org/articles/PMC3519464?pdf=render
collection DOAJ
language English
format Article
sources DOAJ
author Ana Carolina Campi-Azevedo
Luiza Pacheco de Araújo-Porto
Maria Luiza-Silva
Maurício Azevedo Batista
Marina Angela Martins
Renato Sathler-Avelar
Denise da Silveira-Lemos
Luiz Antonio Bastos Camacho
Reinaldo de Menezes Martins
Maria de Lourdes de Sousa Maia
Roberto Henrique Guedes Farias
Marcos da Silva Freire
Ricardo Galler
Akira Homma
José Geraldo Leite Ribeiro
Jandira Aparecida Campos Lemos
Maria Auxiliadora-Martins
Iramaya Rodrigues Caldas
Silvana Maria Elói-Santos
Andréa Teixeira-Carvalho
Olindo Assis Martins-Filho
spellingShingle Ana Carolina Campi-Azevedo
Luiza Pacheco de Araújo-Porto
Maria Luiza-Silva
Maurício Azevedo Batista
Marina Angela Martins
Renato Sathler-Avelar
Denise da Silveira-Lemos
Luiz Antonio Bastos Camacho
Reinaldo de Menezes Martins
Maria de Lourdes de Sousa Maia
Roberto Henrique Guedes Farias
Marcos da Silva Freire
Ricardo Galler
Akira Homma
José Geraldo Leite Ribeiro
Jandira Aparecida Campos Lemos
Maria Auxiliadora-Martins
Iramaya Rodrigues Caldas
Silvana Maria Elói-Santos
Andréa Teixeira-Carvalho
Olindo Assis Martins-Filho
17DD and 17D-213/77 yellow fever substrains trigger a balanced cytokine profile in primary vaccinated children.
PLoS ONE
author_facet Ana Carolina Campi-Azevedo
Luiza Pacheco de Araújo-Porto
Maria Luiza-Silva
Maurício Azevedo Batista
Marina Angela Martins
Renato Sathler-Avelar
Denise da Silveira-Lemos
Luiz Antonio Bastos Camacho
Reinaldo de Menezes Martins
Maria de Lourdes de Sousa Maia
Roberto Henrique Guedes Farias
Marcos da Silva Freire
Ricardo Galler
Akira Homma
José Geraldo Leite Ribeiro
Jandira Aparecida Campos Lemos
Maria Auxiliadora-Martins
Iramaya Rodrigues Caldas
Silvana Maria Elói-Santos
Andréa Teixeira-Carvalho
Olindo Assis Martins-Filho
author_sort Ana Carolina Campi-Azevedo
title 17DD and 17D-213/77 yellow fever substrains trigger a balanced cytokine profile in primary vaccinated children.
title_short 17DD and 17D-213/77 yellow fever substrains trigger a balanced cytokine profile in primary vaccinated children.
title_full 17DD and 17D-213/77 yellow fever substrains trigger a balanced cytokine profile in primary vaccinated children.
title_fullStr 17DD and 17D-213/77 yellow fever substrains trigger a balanced cytokine profile in primary vaccinated children.
title_full_unstemmed 17DD and 17D-213/77 yellow fever substrains trigger a balanced cytokine profile in primary vaccinated children.
title_sort 17dd and 17d-213/77 yellow fever substrains trigger a balanced cytokine profile in primary vaccinated children.
publisher Public Library of Science (PLoS)
series PLoS ONE
issn 1932-6203
publishDate 2012-01-01
description BACKGROUND: This study aimed to compare the cytokine-mediated immune response in children submitted to primary vaccination with the YF-17D-213/77 or YF-17DD yellow fever (YF) substrains. METHODS: A non-probabilistic sample of eighty healthy primary vaccinated (PV) children was selected on the basis of their previously known humoral immune response to the YF vaccines. The selected children were categorized according to their YF-neutralizing antibody titers (PRNT) and referred to as seroconverters (PV-PRNT(+)) or nonseroconverters (PV-PRNT(-)). Following revaccination with the YF-17DD, the PV-PRNT(-) children (YF-17D-213/77 and YF-17DD groups) seroconverted and were referred as RV-PRNT(+). The cytokine-mediated immune response was investigated after short-term in vitro cultures of whole blood samples. The results are expressed as frequency of high cytokine producers, taking the global median of the cytokine index (YF-Ag/control) as the cut-off. RESULTS: The YF-17D-213/77 and the YF-17DD substrains triggered a balanced overall inflammatory/regulatory cytokine pattern in PV-PRNT(+), with a slight predominance of IL-12 in YF-17DD vaccinees and a modest prevalence of IL-10 in YF-17D-213/77. Prominent frequency of neutrophil-derived TNF-α and neutrophils and monocyte-producing IL-12 were the major features of PV-PRNT(+) in the YF-17DD, whereas relevant inflammatory response, mediated by IL-12(+)CD8(+) T cells, was the hallmark of the YF-17D-213/77 vaccinees. Both substrains were able to elicit particular but relevant inflammatory events, regardless of the anti-YF PRNT antibody levels. PV-PRNT(-) children belonging to the YF-17DD arm presented gaps in the inflammatory cytokine signature, especially in terms of the innate immunity, whereas in the YF-17D-213/77 arm the most relevant gap was the deficiency of IL-12-producing CD8(+)T cells. Revaccination with YF-17DD prompted a balanced cytokine profile in YF-17DD nonresponders and a robust inflammatory profile in YF-17D-213/77 nonresponders. CONCLUSION: Our findings demonstrated that, just like the YF-17DD reference vaccine, the YF-17D-213/77 seed lot induced a mixed pattern of inflammatory and regulatory cytokines, supporting its universal use for immunization.
url http://europepmc.org/articles/PMC3519464?pdf=render
work_keys_str_mv AT anacarolinacampiazevedo 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren
AT luizapachecodearaujoporto 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren
AT marialuizasilva 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren
AT mauricioazevedobatista 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren
AT marinaangelamartins 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren
AT renatosathleravelar 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren
AT denisedasilveiralemos 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren
AT luizantoniobastoscamacho 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren
AT reinaldodemenezesmartins 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren
AT mariadelourdesdesousamaia 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren
AT robertohenriqueguedesfarias 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren
AT marcosdasilvafreire 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren
AT ricardogaller 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren
AT akirahomma 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren
AT josegeraldoleiteribeiro 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren
AT jandiraaparecidacamposlemos 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren
AT mariaauxiliadoramartins 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren
AT iramayarodriguescaldas 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren
AT silvanamariaeloisantos 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren
AT andreateixeiracarvalho 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren
AT olindoassismartinsfilho 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren
_version_ 1725017961942482944