Genome-wide characterization and expression profiling of MAPK cascade genes in Salvia miltiorrhiza reveals the function of SmMAPK3 and SmMAPK1 in secondary metabolism
Abstract Background The contribution of mitogen-activated protein kinase (MAPK) cascades to plant growth and development has been widely studied, but this knowledge has not yet been extended to the medicinal plant Salvia miltiorrhiza, which produces a number of pharmacologically active secondary met...
Main Authors: | , , , , , , |
---|---|
Format: | Article |
Language: | English |
Published: |
BMC
2020-09-01
|
Series: | BMC Genomics |
Subjects: | |
Online Access: | http://link.springer.com/article/10.1186/s12864-020-07023-w |
id |
doaj-2fea977a54e346d09d14250833a6654d |
---|---|
record_format |
Article |
spelling |
doaj-2fea977a54e346d09d14250833a6654d2020-11-25T02:36:31ZengBMCBMC Genomics1471-21642020-09-0121111510.1186/s12864-020-07023-wGenome-wide characterization and expression profiling of MAPK cascade genes in Salvia miltiorrhiza reveals the function of SmMAPK3 and SmMAPK1 in secondary metabolismYongfeng Xie0Meiling Ding1Bin Zhang2Jie Yang3Tianlin Pei4Pengda Ma5Juane Dong6College of Life Sciences, Northwest A&F UniversityCollege of Life Sciences, Northwest A&F UniversityCollege of Life Sciences, Northwest A&F UniversityCollege of Life Sciences, Northwest A&F UniversityShanghai Key Laboratory of Plant Functional Genomics and Resources, Shanghai Chenshan Botanical Garden, Shanghai Chenshan Plant Science Research Center, Chinese Academy of SciencesCollege of Life Sciences, Northwest A&F UniversityCollege of Life Sciences, Northwest A&F UniversityAbstract Background The contribution of mitogen-activated protein kinase (MAPK) cascades to plant growth and development has been widely studied, but this knowledge has not yet been extended to the medicinal plant Salvia miltiorrhiza, which produces a number of pharmacologically active secondary metabolites. Results In this study, we performed a genome-wide survey and identified six MAPKKK kinases (MAPKKKKs), 83 MAPKK kinases (MAPKKKs), nine MAPK kinases (MAPKKs) and 18 MAPKs in the S. miltiorrhiza genome. Within each class of genes, a small number of subfamilies were recognized. A transcriptional analysis revealed differences in the genes’ behaviour with respect to both their site of transcription and their inducibility by elicitors and phytohormones. Two genes were identified as strong candidates for playing roles in phytohormone signalling. A gene-to-metabolite network was constructed based on correlation analysis, highlighting the likely involvement of two of the cascades in the synthesis of two key groups of pharmacologically active secondary metabolites: phenolic acids and tanshinones. Conclusion The data provide insight into the functional diversification and conservation of MAPK cascades in S. miltiorrhiza.http://link.springer.com/article/10.1186/s12864-020-07023-wSalvia miltiorrhizaGene familyMAPK cascadesCo-expression analysisPhenolic acid synthesisTanshinone synthesis |
collection |
DOAJ |
language |
English |
format |
Article |
sources |
DOAJ |
author |
Yongfeng Xie Meiling Ding Bin Zhang Jie Yang Tianlin Pei Pengda Ma Juane Dong |
spellingShingle |
Yongfeng Xie Meiling Ding Bin Zhang Jie Yang Tianlin Pei Pengda Ma Juane Dong Genome-wide characterization and expression profiling of MAPK cascade genes in Salvia miltiorrhiza reveals the function of SmMAPK3 and SmMAPK1 in secondary metabolism BMC Genomics Salvia miltiorrhiza Gene family MAPK cascades Co-expression analysis Phenolic acid synthesis Tanshinone synthesis |
author_facet |
Yongfeng Xie Meiling Ding Bin Zhang Jie Yang Tianlin Pei Pengda Ma Juane Dong |
author_sort |
Yongfeng Xie |
title |
Genome-wide characterization and expression profiling of MAPK cascade genes in Salvia miltiorrhiza reveals the function of SmMAPK3 and SmMAPK1 in secondary metabolism |
title_short |
Genome-wide characterization and expression profiling of MAPK cascade genes in Salvia miltiorrhiza reveals the function of SmMAPK3 and SmMAPK1 in secondary metabolism |
title_full |
Genome-wide characterization and expression profiling of MAPK cascade genes in Salvia miltiorrhiza reveals the function of SmMAPK3 and SmMAPK1 in secondary metabolism |
title_fullStr |
Genome-wide characterization and expression profiling of MAPK cascade genes in Salvia miltiorrhiza reveals the function of SmMAPK3 and SmMAPK1 in secondary metabolism |
title_full_unstemmed |
Genome-wide characterization and expression profiling of MAPK cascade genes in Salvia miltiorrhiza reveals the function of SmMAPK3 and SmMAPK1 in secondary metabolism |
title_sort |
genome-wide characterization and expression profiling of mapk cascade genes in salvia miltiorrhiza reveals the function of smmapk3 and smmapk1 in secondary metabolism |
publisher |
BMC |
series |
BMC Genomics |
issn |
1471-2164 |
publishDate |
2020-09-01 |
description |
Abstract Background The contribution of mitogen-activated protein kinase (MAPK) cascades to plant growth and development has been widely studied, but this knowledge has not yet been extended to the medicinal plant Salvia miltiorrhiza, which produces a number of pharmacologically active secondary metabolites. Results In this study, we performed a genome-wide survey and identified six MAPKKK kinases (MAPKKKKs), 83 MAPKK kinases (MAPKKKs), nine MAPK kinases (MAPKKs) and 18 MAPKs in the S. miltiorrhiza genome. Within each class of genes, a small number of subfamilies were recognized. A transcriptional analysis revealed differences in the genes’ behaviour with respect to both their site of transcription and their inducibility by elicitors and phytohormones. Two genes were identified as strong candidates for playing roles in phytohormone signalling. A gene-to-metabolite network was constructed based on correlation analysis, highlighting the likely involvement of two of the cascades in the synthesis of two key groups of pharmacologically active secondary metabolites: phenolic acids and tanshinones. Conclusion The data provide insight into the functional diversification and conservation of MAPK cascades in S. miltiorrhiza. |
topic |
Salvia miltiorrhiza Gene family MAPK cascades Co-expression analysis Phenolic acid synthesis Tanshinone synthesis |
url |
http://link.springer.com/article/10.1186/s12864-020-07023-w |
work_keys_str_mv |
AT yongfengxie genomewidecharacterizationandexpressionprofilingofmapkcascadegenesinsalviamiltiorrhizarevealsthefunctionofsmmapk3andsmmapk1insecondarymetabolism AT meilingding genomewidecharacterizationandexpressionprofilingofmapkcascadegenesinsalviamiltiorrhizarevealsthefunctionofsmmapk3andsmmapk1insecondarymetabolism AT binzhang genomewidecharacterizationandexpressionprofilingofmapkcascadegenesinsalviamiltiorrhizarevealsthefunctionofsmmapk3andsmmapk1insecondarymetabolism AT jieyang genomewidecharacterizationandexpressionprofilingofmapkcascadegenesinsalviamiltiorrhizarevealsthefunctionofsmmapk3andsmmapk1insecondarymetabolism AT tianlinpei genomewidecharacterizationandexpressionprofilingofmapkcascadegenesinsalviamiltiorrhizarevealsthefunctionofsmmapk3andsmmapk1insecondarymetabolism AT pengdama genomewidecharacterizationandexpressionprofilingofmapkcascadegenesinsalviamiltiorrhizarevealsthefunctionofsmmapk3andsmmapk1insecondarymetabolism AT juanedong genomewidecharacterizationandexpressionprofilingofmapkcascadegenesinsalviamiltiorrhizarevealsthefunctionofsmmapk3andsmmapk1insecondarymetabolism |
_version_ |
1724799607955783680 |