Fuelling of TCA cycle in hepatic cells Marwari goat during ambient temperature associated stress

The present study was launched to assess the effect of extreme ambient temperature associated stress on fuelling of TCA cycle in hepatic cells of Marwari goat. Based on the fact that whenever a hepatocyte needs fuel for TCA cycle, the activity of enzyme glutamate dehydrogenase (GD) increases making...

Full description

Bibliographic Details
Main Authors: Kataria N., Kataria A.K., Joshi A.
Format: Article
Language:English
Published: "Vikol publishing" ST Kolesnichenko V.V. 2010-11-01
Series:Journal of Stress Physiology & Biochemistry
Subjects:
hot
Online Access:http://www.jspb.ru/issues/2010/N4/JSPB_2010_4_05-11.pdf
id doaj-40df9e14dad64a419838399f2d850307
record_format Article
spelling doaj-40df9e14dad64a419838399f2d8503072020-11-24T23:16:12Zeng"Vikol publishing" ST Kolesnichenko V.V. Journal of Stress Physiology & Biochemistry1997-08382010-11-0164511Fuelling of TCA cycle in hepatic cells Marwari goat during ambient temperature associated stressKataria N.Kataria A.K.Joshi A.The present study was launched to assess the effect of extreme ambient temperature associated stress on fuelling of TCA cycle in hepatic cells of Marwari goat. Based on the fact that whenever a hepatocyte needs fuel for TCA cycle, the activity of enzyme glutamate dehydrogenase (GD) increases making alpha-ketoglutarate available for TCA cycle, 600 apparently healthy Marwari goats of either sex, between 6 months to 3 years of age were screened and blood samples were collected during moderate, cold and hot ambient temperature periods to determine the serum glutamate dehydrogenase enzyme and glucose concentration. The mean value of serum GD was significantly (p≤0.05) higher during cold and hot ambient temperature periods in comparison to overall moderate mean value. However, the rise was greater in cold (2.20 times) than hot ambient temperature (1.19 times). The serum GD activity was higher in male and younger animals. Serum glucose concentration showed a reverse trend as compared to serum GD activity. The results indicated that in cold condition associated stress the fuelling to TCA cycle was more than moderate and hot ambient temperature periods. Serum GD activity was also found related with glucose homeostasis. Further the study has shown that variations in the enzyme levels are not always pathological and while interpreting clinical data, a clinician must consider these variations. http://www.jspb.ru/issues/2010/N4/JSPB_2010_4_05-11.pdfAmbient temperaturecoldglucoseglutamate DehydrogenasehotMarwari goat
collection DOAJ
language English
format Article
sources DOAJ
author Kataria N.
Kataria A.K.
Joshi A.
spellingShingle Kataria N.
Kataria A.K.
Joshi A.
Fuelling of TCA cycle in hepatic cells Marwari goat during ambient temperature associated stress
Journal of Stress Physiology & Biochemistry
Ambient temperature
cold
glucose
glutamate Dehydrogenase
hot
Marwari goat
author_facet Kataria N.
Kataria A.K.
Joshi A.
author_sort Kataria N.
title Fuelling of TCA cycle in hepatic cells Marwari goat during ambient temperature associated stress
title_short Fuelling of TCA cycle in hepatic cells Marwari goat during ambient temperature associated stress
title_full Fuelling of TCA cycle in hepatic cells Marwari goat during ambient temperature associated stress
title_fullStr Fuelling of TCA cycle in hepatic cells Marwari goat during ambient temperature associated stress
title_full_unstemmed Fuelling of TCA cycle in hepatic cells Marwari goat during ambient temperature associated stress
title_sort fuelling of tca cycle in hepatic cells marwari goat during ambient temperature associated stress
publisher "Vikol publishing" ST Kolesnichenko V.V.
series Journal of Stress Physiology & Biochemistry
issn 1997-0838
publishDate 2010-11-01
description The present study was launched to assess the effect of extreme ambient temperature associated stress on fuelling of TCA cycle in hepatic cells of Marwari goat. Based on the fact that whenever a hepatocyte needs fuel for TCA cycle, the activity of enzyme glutamate dehydrogenase (GD) increases making alpha-ketoglutarate available for TCA cycle, 600 apparently healthy Marwari goats of either sex, between 6 months to 3 years of age were screened and blood samples were collected during moderate, cold and hot ambient temperature periods to determine the serum glutamate dehydrogenase enzyme and glucose concentration. The mean value of serum GD was significantly (p≤0.05) higher during cold and hot ambient temperature periods in comparison to overall moderate mean value. However, the rise was greater in cold (2.20 times) than hot ambient temperature (1.19 times). The serum GD activity was higher in male and younger animals. Serum glucose concentration showed a reverse trend as compared to serum GD activity. The results indicated that in cold condition associated stress the fuelling to TCA cycle was more than moderate and hot ambient temperature periods. Serum GD activity was also found related with glucose homeostasis. Further the study has shown that variations in the enzyme levels are not always pathological and while interpreting clinical data, a clinician must consider these variations.
topic Ambient temperature
cold
glucose
glutamate Dehydrogenase
hot
Marwari goat
url http://www.jspb.ru/issues/2010/N4/JSPB_2010_4_05-11.pdf
work_keys_str_mv AT katarian fuellingoftcacycleinhepaticcellsmarwarigoatduringambienttemperatureassociatedstress
AT katariaak fuellingoftcacycleinhepaticcellsmarwarigoatduringambienttemperatureassociatedstress
AT joshia fuellingoftcacycleinhepaticcellsmarwarigoatduringambienttemperatureassociatedstress
_version_ 1725588417460305920