Comparison of oropharyngeal leak pressure of air-Q™,i-gel™, and laryngeal mask airway supreme™ in adult patients during general anesthesia: A randomized controlled trial

Study Objective: Various randomized controlled trials and a meta-analysis have compared i-gel™ and laryngeal mask airway Supreme™ (LMA-S™) in adult patients and found that both the devices provided equivalent oropharyngeal leak pressure (OLP). However, no randomized controlled trial has compared air...

Full description

Bibliographic Details
Main Authors: Srinath Damodaran, Sameer Sethi, Surender Kumar Malhotra, Tanvir Samra, Souvik Maitra, Vikas Saini
Format: Article
Language:English
Published: Wolters Kluwer Medknow Publications 2017-01-01
Series:Saudi Journal of Anaesthesia
Subjects:
Online Access:http://www.saudija.org/article.asp?issn=1658-354X;year=2017;volume=11;issue=4;spage=390;epage=395;aulast=Damodaran
id doaj-41a27f278266417a99561ab4b130710e
record_format Article
spelling doaj-41a27f278266417a99561ab4b130710e2020-11-24T22:46:50ZengWolters Kluwer Medknow PublicationsSaudi Journal of Anaesthesia1658-354X2017-01-0111439039510.4103/sja.SJA_149_17Comparison of oropharyngeal leak pressure of air-Q™,i-gel™, and laryngeal mask airway supreme™ in adult patients during general anesthesia: A randomized controlled trialSrinath DamodaranSameer SethiSurender Kumar MalhotraTanvir SamraSouvik MaitraVikas SainiStudy Objective: Various randomized controlled trials and a meta-analysis have compared i-gel™ and laryngeal mask airway Supreme™ (LMA-S™) in adult patients and found that both the devices provided equivalent oropharyngeal leak pressure (OLP). However, no randomized controlled trial has compared air-Q™ with i-gel™ and LMA-S™ in adult patient. Hence, we designed this study to compare air-Q™ with LMA-S™ and i-gel™ in adult patients. Materials and Methods: A total of 75 adult patients of the American Society of Anesthesiologists physical status I/II of both sexes, between 18 and 60 years, were included in this prospective randomized controlled trial conducted in a tertiary care center. Randomization of patients was done in three equal groups according to the insertion of supraglottic airway device by a computer-generated random number sequence: group air-Q™ (n = 25), group i-gel™ (n = 25), and group LMA-S™ (n = 25). Primary outcome of this study was OLP. We also recorded time for successful placement of device, ease of device insertion, number of attempts to insert device, and ease of gastric tube insertion along with postoperative complications. Results: The mean ± standard deviation OLP of air-Q™, i-gel™, and LMA-S™ was 26.13 ± 4.957 cm, 23.75 ± 5.439 cm, and 24.80 ± 4.78 cm H2O (P = 0.279). The first insertion success rate for air-Q™, i-gel™, and LMA-S™ was 80%, 76%, and 92%, respectively (P = 0.353). The insertion time of air-Q™, i-gel™, and LMA-S™ was 20.6 ± 4.4, 14.8 ± 5.4, and 15.2 ± 4.7 s, respectively (P = 0.000). Time taken for air-Q™ insertion was significantly higher than time taken for i-gel™ (mean difference 5.8 s, P < 0.0001) and LMA-S™ (mean difference 5.4 s, P = 0.0001) insertion. Postoperative complications were similar with all three devices. Conclusions: We concluded that air-Q™, i-gel™, and LMA-S™ were equally efficacious in terms of routine airway management in adult patients with normal airway anatomy.http://www.saudija.org/article.asp?issn=1658-354X;year=2017;volume=11;issue=4;spage=390;epage=395;aulast=DamodaranAir-Q™; i-gel; laryngeal mask airway Supreme™; oropharyngeal leak pressure; randomized controlled trial
collection DOAJ
language English
format Article
sources DOAJ
author Srinath Damodaran
Sameer Sethi
Surender Kumar Malhotra
Tanvir Samra
Souvik Maitra
Vikas Saini
spellingShingle Srinath Damodaran
Sameer Sethi
Surender Kumar Malhotra
Tanvir Samra
Souvik Maitra
Vikas Saini
Comparison of oropharyngeal leak pressure of air-Q™,i-gel™, and laryngeal mask airway supreme™ in adult patients during general anesthesia: A randomized controlled trial
Saudi Journal of Anaesthesia
Air-Q™; i-gel; laryngeal mask airway Supreme™; oropharyngeal leak pressure; randomized controlled trial
author_facet Srinath Damodaran
Sameer Sethi
Surender Kumar Malhotra
Tanvir Samra
Souvik Maitra
Vikas Saini
author_sort Srinath Damodaran
title Comparison of oropharyngeal leak pressure of air-Q™,i-gel™, and laryngeal mask airway supreme™ in adult patients during general anesthesia: A randomized controlled trial
title_short Comparison of oropharyngeal leak pressure of air-Q™,i-gel™, and laryngeal mask airway supreme™ in adult patients during general anesthesia: A randomized controlled trial
title_full Comparison of oropharyngeal leak pressure of air-Q™,i-gel™, and laryngeal mask airway supreme™ in adult patients during general anesthesia: A randomized controlled trial
title_fullStr Comparison of oropharyngeal leak pressure of air-Q™,i-gel™, and laryngeal mask airway supreme™ in adult patients during general anesthesia: A randomized controlled trial
title_full_unstemmed Comparison of oropharyngeal leak pressure of air-Q™,i-gel™, and laryngeal mask airway supreme™ in adult patients during general anesthesia: A randomized controlled trial
title_sort comparison of oropharyngeal leak pressure of air-q™,i-gel™, and laryngeal mask airway supreme™ in adult patients during general anesthesia: a randomized controlled trial
publisher Wolters Kluwer Medknow Publications
series Saudi Journal of Anaesthesia
issn 1658-354X
publishDate 2017-01-01
description Study Objective: Various randomized controlled trials and a meta-analysis have compared i-gel™ and laryngeal mask airway Supreme™ (LMA-S™) in adult patients and found that both the devices provided equivalent oropharyngeal leak pressure (OLP). However, no randomized controlled trial has compared air-Q™ with i-gel™ and LMA-S™ in adult patient. Hence, we designed this study to compare air-Q™ with LMA-S™ and i-gel™ in adult patients. Materials and Methods: A total of 75 adult patients of the American Society of Anesthesiologists physical status I/II of both sexes, between 18 and 60 years, were included in this prospective randomized controlled trial conducted in a tertiary care center. Randomization of patients was done in three equal groups according to the insertion of supraglottic airway device by a computer-generated random number sequence: group air-Q™ (n = 25), group i-gel™ (n = 25), and group LMA-S™ (n = 25). Primary outcome of this study was OLP. We also recorded time for successful placement of device, ease of device insertion, number of attempts to insert device, and ease of gastric tube insertion along with postoperative complications. Results: The mean ± standard deviation OLP of air-Q™, i-gel™, and LMA-S™ was 26.13 ± 4.957 cm, 23.75 ± 5.439 cm, and 24.80 ± 4.78 cm H2O (P = 0.279). The first insertion success rate for air-Q™, i-gel™, and LMA-S™ was 80%, 76%, and 92%, respectively (P = 0.353). The insertion time of air-Q™, i-gel™, and LMA-S™ was 20.6 ± 4.4, 14.8 ± 5.4, and 15.2 ± 4.7 s, respectively (P = 0.000). Time taken for air-Q™ insertion was significantly higher than time taken for i-gel™ (mean difference 5.8 s, P < 0.0001) and LMA-S™ (mean difference 5.4 s, P = 0.0001) insertion. Postoperative complications were similar with all three devices. Conclusions: We concluded that air-Q™, i-gel™, and LMA-S™ were equally efficacious in terms of routine airway management in adult patients with normal airway anatomy.
topic Air-Q™; i-gel; laryngeal mask airway Supreme™; oropharyngeal leak pressure; randomized controlled trial
url http://www.saudija.org/article.asp?issn=1658-354X;year=2017;volume=11;issue=4;spage=390;epage=395;aulast=Damodaran
work_keys_str_mv AT srinathdamodaran comparisonoforopharyngealleakpressureofairqigelandlaryngealmaskairwaysupremeinadultpatientsduringgeneralanesthesiaarandomizedcontrolledtrial
AT sameersethi comparisonoforopharyngealleakpressureofairqigelandlaryngealmaskairwaysupremeinadultpatientsduringgeneralanesthesiaarandomizedcontrolledtrial
AT surenderkumarmalhotra comparisonoforopharyngealleakpressureofairqigelandlaryngealmaskairwaysupremeinadultpatientsduringgeneralanesthesiaarandomizedcontrolledtrial
AT tanvirsamra comparisonoforopharyngealleakpressureofairqigelandlaryngealmaskairwaysupremeinadultpatientsduringgeneralanesthesiaarandomizedcontrolledtrial
AT souvikmaitra comparisonoforopharyngealleakpressureofairqigelandlaryngealmaskairwaysupremeinadultpatientsduringgeneralanesthesiaarandomizedcontrolledtrial
AT vikassaini comparisonoforopharyngealleakpressureofairqigelandlaryngealmaskairwaysupremeinadultpatientsduringgeneralanesthesiaarandomizedcontrolledtrial
_version_ 1725683535080062976