Antibacterial and Anti-Inflammatory Activities of Physalis Alkekengi var. franchetii and Its Main Constituents
This study was designed to determine whether the 50% EtOH fraction from AB-8 macroporous resin fractionation of a 70% EtOH extract of P. Alkekengi (50-EFP) has antibacterial and/or anti-inflammatory activity both in vivo and in vitro and to investigate the mechanism of 50-EFP anti-inflammatory activ...
Main Authors: | , , , , , , |
---|---|
Format: | Article |
Language: | English |
Published: |
Hindawi Limited
2016-01-01
|
Series: | Evidence-Based Complementary and Alternative Medicine |
Online Access: | http://dx.doi.org/10.1155/2016/4359394 |
id |
doaj-42ff67c66282447d8f6a2cc45d0abf95 |
---|---|
record_format |
Article |
spelling |
doaj-42ff67c66282447d8f6a2cc45d0abf952020-11-25T00:03:02ZengHindawi LimitedEvidence-Based Complementary and Alternative Medicine1741-427X1741-42882016-01-01201610.1155/2016/43593944359394Antibacterial and Anti-Inflammatory Activities of Physalis Alkekengi var. franchetii and Its Main ConstituentsZunpeng Shu0Na Xing1Qiuhong Wang2Xinli Li3Bingqing Xu4Zhenyu Li5Haixue Kuang6Key Laboratory of Chinese Materia Medica (Ministry of Education), Heilongjiang University of Chinese Medicine, No. 28 Heping Road, Xiangfang District, Harbin, Heilongjiang 150040, ChinaKey Laboratory of Chinese Materia Medica (Ministry of Education), Heilongjiang University of Chinese Medicine, No. 28 Heping Road, Xiangfang District, Harbin, Heilongjiang 150040, ChinaKey Laboratory of Chinese Materia Medica (Ministry of Education), Heilongjiang University of Chinese Medicine, No. 28 Heping Road, Xiangfang District, Harbin, Heilongjiang 150040, ChinaDepartments of Biotechnology, Dalian Medical University, Dalian, Liaoning 116044, ChinaKey Laboratory of Chinese Materia Medica (Ministry of Education), Heilongjiang University of Chinese Medicine, No. 28 Heping Road, Xiangfang District, Harbin, Heilongjiang 150040, ChinaKey Laboratory of Chinese Materia Medica (Ministry of Education), Heilongjiang University of Chinese Medicine, No. 28 Heping Road, Xiangfang District, Harbin, Heilongjiang 150040, ChinaKey Laboratory of Chinese Materia Medica (Ministry of Education), Heilongjiang University of Chinese Medicine, No. 28 Heping Road, Xiangfang District, Harbin, Heilongjiang 150040, ChinaThis study was designed to determine whether the 50% EtOH fraction from AB-8 macroporous resin fractionation of a 70% EtOH extract of P. Alkekengi (50-EFP) has antibacterial and/or anti-inflammatory activity both in vivo and in vitro and to investigate the mechanism of 50-EFP anti-inflammatory activity. Additionally, this study sought to define the chemical composition of 50-EFP. Results indicated that 50-EFP showed significant antibacterial activity in vitro and efficacy in vivo. Moreover, 50-EFP significantly reduced nitric oxide (NO), prostaglandin E2 (PGE2), tumor necrosis factor alpha (TNF-α), interleukin 1 (IL-1), and interleukin 6 (IL-6) production in lipopolysaccharide- (LPS-) stimulated THP-1 cells. Nitric oxide synthase (iNOS) and cyclooxygenase-2 (COX-2) (examined at the protein level) in THP-1 cells were suppressed by 50-EFP, which inhibited nuclear translocation of p65. Consistent with this anti-inflammatory activity in vitro, 50-EFP reduced inflammation in both animal models. Finally, seventeen compounds (8 physalins and 9 flavones) were isolated as major components of 50-EFP. Our data demonstrate that 50-EFP has antibacterial and anti-inflammatory activities both in vitro and in vivo. The anti-inflammatory effect appears to occur, at least in part, through the inhibition of nuclear translocation of p65. Moreover, physalins and flavones are probably the active components in 50-EFP that exert antibacterial and anti-inflammatory activities.http://dx.doi.org/10.1155/2016/4359394 |
collection |
DOAJ |
language |
English |
format |
Article |
sources |
DOAJ |
author |
Zunpeng Shu Na Xing Qiuhong Wang Xinli Li Bingqing Xu Zhenyu Li Haixue Kuang |
spellingShingle |
Zunpeng Shu Na Xing Qiuhong Wang Xinli Li Bingqing Xu Zhenyu Li Haixue Kuang Antibacterial and Anti-Inflammatory Activities of Physalis Alkekengi var. franchetii and Its Main Constituents Evidence-Based Complementary and Alternative Medicine |
author_facet |
Zunpeng Shu Na Xing Qiuhong Wang Xinli Li Bingqing Xu Zhenyu Li Haixue Kuang |
author_sort |
Zunpeng Shu |
title |
Antibacterial and Anti-Inflammatory Activities of Physalis Alkekengi var. franchetii and Its Main Constituents |
title_short |
Antibacterial and Anti-Inflammatory Activities of Physalis Alkekengi var. franchetii and Its Main Constituents |
title_full |
Antibacterial and Anti-Inflammatory Activities of Physalis Alkekengi var. franchetii and Its Main Constituents |
title_fullStr |
Antibacterial and Anti-Inflammatory Activities of Physalis Alkekengi var. franchetii and Its Main Constituents |
title_full_unstemmed |
Antibacterial and Anti-Inflammatory Activities of Physalis Alkekengi var. franchetii and Its Main Constituents |
title_sort |
antibacterial and anti-inflammatory activities of physalis alkekengi var. franchetii and its main constituents |
publisher |
Hindawi Limited |
series |
Evidence-Based Complementary and Alternative Medicine |
issn |
1741-427X 1741-4288 |
publishDate |
2016-01-01 |
description |
This study was designed to determine whether the 50% EtOH fraction from AB-8 macroporous resin fractionation of a 70% EtOH extract of P. Alkekengi (50-EFP) has antibacterial and/or anti-inflammatory activity both in vivo and in vitro and to investigate the mechanism of 50-EFP anti-inflammatory activity. Additionally, this study sought to define the chemical composition of 50-EFP. Results indicated that 50-EFP showed significant antibacterial activity in vitro and efficacy in vivo. Moreover, 50-EFP significantly reduced nitric oxide (NO), prostaglandin E2 (PGE2), tumor necrosis factor alpha (TNF-α), interleukin 1 (IL-1), and interleukin 6 (IL-6) production in lipopolysaccharide- (LPS-) stimulated THP-1 cells. Nitric oxide synthase (iNOS) and cyclooxygenase-2 (COX-2) (examined at the protein level) in THP-1 cells were suppressed by 50-EFP, which inhibited nuclear translocation of p65. Consistent with this anti-inflammatory activity in vitro, 50-EFP reduced inflammation in both animal models. Finally, seventeen compounds (8 physalins and 9 flavones) were isolated as major components of 50-EFP. Our data demonstrate that 50-EFP has antibacterial and anti-inflammatory activities both in vitro and in vivo. The anti-inflammatory effect appears to occur, at least in part, through the inhibition of nuclear translocation of p65. Moreover, physalins and flavones are probably the active components in 50-EFP that exert antibacterial and anti-inflammatory activities. |
url |
http://dx.doi.org/10.1155/2016/4359394 |
work_keys_str_mv |
AT zunpengshu antibacterialandantiinflammatoryactivitiesofphysalisalkekengivarfranchetiianditsmainconstituents AT naxing antibacterialandantiinflammatoryactivitiesofphysalisalkekengivarfranchetiianditsmainconstituents AT qiuhongwang antibacterialandantiinflammatoryactivitiesofphysalisalkekengivarfranchetiianditsmainconstituents AT xinlili antibacterialandantiinflammatoryactivitiesofphysalisalkekengivarfranchetiianditsmainconstituents AT bingqingxu antibacterialandantiinflammatoryactivitiesofphysalisalkekengivarfranchetiianditsmainconstituents AT zhenyuli antibacterialandantiinflammatoryactivitiesofphysalisalkekengivarfranchetiianditsmainconstituents AT haixuekuang antibacterialandantiinflammatoryactivitiesofphysalisalkekengivarfranchetiianditsmainconstituents |
_version_ |
1725435386345291776 |