Activation of MAPK ERK in peripheral nerve after injury

<p>Abstract</p> <p>Background</p> <p>Activation of extracellular signal-regulated protein kinase (ERK), a member of mitogen-activated protein kinase (MAPK) family, has been proposed to mediate neurite outgrowth-promoting effects of several neurotrophic factors <it>...

Full description

Bibliographic Details
Main Authors: Tanomsridejchai N, Kaewsema A, Agthong S, Chentanez V
Format: Article
Language:English
Published: BMC 2006-06-01
Series:BMC Neuroscience
Online Access:http://www.biomedcentral.com/1471-2202/7/45
id doaj-456170a64ce24877918e047b7a972ea7
record_format Article
spelling doaj-456170a64ce24877918e047b7a972ea72020-11-24T23:17:49ZengBMCBMC Neuroscience1471-22022006-06-01714510.1186/1471-2202-7-45Activation of MAPK ERK in peripheral nerve after injuryTanomsridejchai NKaewsema AAgthong SChentanez V<p>Abstract</p> <p>Background</p> <p>Activation of extracellular signal-regulated protein kinase (ERK), a member of mitogen-activated protein kinase (MAPK) family, has been proposed to mediate neurite outgrowth-promoting effects of several neurotrophic factors <it>in vitro</it>. However, the precise activity of ERK during axonal regeneration <it>in vivo </it>remains unclear. Peripheral axotomy has been shown to activate ERK in the cell bodies of primary afferent neurons and associated satellite cells. Nevertheless, whether ERK is also activated in the axons and surrounded Schwann cells which also play a key role in the regeneration process has not been clarified.</p> <p>Results</p> <p>Phosphorylation of ERK in the sciatic nerve in several time-points after crush injury has been examined. Higher phosphorylation of ERK was observed in the proximal and distal nerve stumps compared to the contralateral intact nerve from one day to one month after crush. The activation of ERK was mainly localized in the axons of the proximal segments. In the distal segments, however, active ERK was predominantly found in Schwann cells forming Bungner's bands.</p> <p>Conclusion</p> <p>The findings indicate that ERK is activated in both the proximal and distal nerve stumps following nerve injury. The role of activated ERK in Wallerian degeneration and subsequent regeneration <it>in vivo </it>remains to be elucidated.</p> http://www.biomedcentral.com/1471-2202/7/45
collection DOAJ
language English
format Article
sources DOAJ
author Tanomsridejchai N
Kaewsema A
Agthong S
Chentanez V
spellingShingle Tanomsridejchai N
Kaewsema A
Agthong S
Chentanez V
Activation of MAPK ERK in peripheral nerve after injury
BMC Neuroscience
author_facet Tanomsridejchai N
Kaewsema A
Agthong S
Chentanez V
author_sort Tanomsridejchai N
title Activation of MAPK ERK in peripheral nerve after injury
title_short Activation of MAPK ERK in peripheral nerve after injury
title_full Activation of MAPK ERK in peripheral nerve after injury
title_fullStr Activation of MAPK ERK in peripheral nerve after injury
title_full_unstemmed Activation of MAPK ERK in peripheral nerve after injury
title_sort activation of mapk erk in peripheral nerve after injury
publisher BMC
series BMC Neuroscience
issn 1471-2202
publishDate 2006-06-01
description <p>Abstract</p> <p>Background</p> <p>Activation of extracellular signal-regulated protein kinase (ERK), a member of mitogen-activated protein kinase (MAPK) family, has been proposed to mediate neurite outgrowth-promoting effects of several neurotrophic factors <it>in vitro</it>. However, the precise activity of ERK during axonal regeneration <it>in vivo </it>remains unclear. Peripheral axotomy has been shown to activate ERK in the cell bodies of primary afferent neurons and associated satellite cells. Nevertheless, whether ERK is also activated in the axons and surrounded Schwann cells which also play a key role in the regeneration process has not been clarified.</p> <p>Results</p> <p>Phosphorylation of ERK in the sciatic nerve in several time-points after crush injury has been examined. Higher phosphorylation of ERK was observed in the proximal and distal nerve stumps compared to the contralateral intact nerve from one day to one month after crush. The activation of ERK was mainly localized in the axons of the proximal segments. In the distal segments, however, active ERK was predominantly found in Schwann cells forming Bungner's bands.</p> <p>Conclusion</p> <p>The findings indicate that ERK is activated in both the proximal and distal nerve stumps following nerve injury. The role of activated ERK in Wallerian degeneration and subsequent regeneration <it>in vivo </it>remains to be elucidated.</p>
url http://www.biomedcentral.com/1471-2202/7/45
work_keys_str_mv AT tanomsridejchain activationofmapkerkinperipheralnerveafterinjury
AT kaewsemaa activationofmapkerkinperipheralnerveafterinjury
AT agthongs activationofmapkerkinperipheralnerveafterinjury
AT chentanezv activationofmapkerkinperipheralnerveafterinjury
_version_ 1725583169511489536