Determinant Of Chronic Energy Deficiency (Kek) In Pregnant Women In The Working Area Of Siak Hulu Iii Health Center Of Kampar Regency

Chronic Energy Deficiency (CED) pregnant women is a situation where a pregnant woman experiences nutritional deficiencies (calories and protein) that have long or chronic competition. In 2018, national the prevalence of CED in pregnant women is 17,3%, and the Siak Health Center prevalence of CED de...

Full description

Bibliographic Details
Main Authors: Sintia Sintia, Winda Septiani, Novita Rany, Elmia Kursani
Format: Article
Language:Indonesian
Published: STIKes Hang Tuah Pekanbaru 2021-04-01
Series:Jurnal Kesehatan Komunitas (Journal of Community Health)
Online Access:https://jurnal.htp.ac.id/index.php/keskom/article/view/775
id doaj-46662812005743d6861c9da814152b99
record_format Article
spelling doaj-46662812005743d6861c9da814152b992021-05-12T13:33:19ZindSTIKes Hang Tuah PekanbaruJurnal Kesehatan Komunitas (Journal of Community Health)2088-76122548-85382021-04-017110.25311/keskom.Vol7.Iss1.775Determinant Of Chronic Energy Deficiency (Kek) In Pregnant Women In The Working Area Of Siak Hulu Iii Health Center Of Kampar RegencySintia Sintia0Winda Septiani1Novita Rany2Elmia Kursani3Program Studi Kesehatan Masyarakat, STIKes Hang Tuah PekanbaruProgram Studi Kesehatan Masyarakat, STIKes Hang Tuah PekanbaruProgram Studi Kesehatan Masyarakat, STIKes Hang Tuah PekanbaruProgram Studi Kesehatan Masyarakat, STIKes Hang Tuah Pekanbaru Chronic Energy Deficiency (CED) pregnant women is a situation where a pregnant woman experiences nutritional deficiencies (calories and protein) that have long or chronic competition. In 2018, national the prevalence of CED in pregnant women is 17,3%, and the Siak Health Center prevalence of CED deficiency in pregnant women was 21,4%. The purpose of this research was to determine the factors that influence the CED in pregnant women in the working area of the Siak Hulu III Health Center of Kampar district. The method of this research was a descriptive quantitative analytical study with a cross-sectional design. The sample was 70 respondents in the working area Puskesmas Siak Hulu III. The sampling technique was consecutive sampling with the dependent variable, namely pregnant women with CED if the upper circumference <23,5 cm, and the dependent variable was knowledge, infectious disease, family income, parity, and hyperemesis gravidarum. The data analysis was a bivariate analysis with the Chi-Square test. The instrument used questionnaires and data processing using computerized. The results showed a correlation between knowledge on pregnant women CED (p-value 0,158 OR = 2,602), the influence of infectious diseases on pregnant women CED (p-value 0,003 OR = 5,881), family income (p-value 0,025 OR = 0,231), parity) (p-value 0,025 OR = 4,333), and hyperemesis gravidarum (p-value 0,017 OR = 3,934). It can be concluded that there is an influence between infectious disease, family income, parity, hyperemesis gravidarum, and health workers, in particular, are expected to be able to provide information.   https://jurnal.htp.ac.id/index.php/keskom/article/view/775
collection DOAJ
language Indonesian
format Article
sources DOAJ
author Sintia Sintia
Winda Septiani
Novita Rany
Elmia Kursani
spellingShingle Sintia Sintia
Winda Septiani
Novita Rany
Elmia Kursani
Determinant Of Chronic Energy Deficiency (Kek) In Pregnant Women In The Working Area Of Siak Hulu Iii Health Center Of Kampar Regency
Jurnal Kesehatan Komunitas (Journal of Community Health)
author_facet Sintia Sintia
Winda Septiani
Novita Rany
Elmia Kursani
author_sort Sintia Sintia
title Determinant Of Chronic Energy Deficiency (Kek) In Pregnant Women In The Working Area Of Siak Hulu Iii Health Center Of Kampar Regency
title_short Determinant Of Chronic Energy Deficiency (Kek) In Pregnant Women In The Working Area Of Siak Hulu Iii Health Center Of Kampar Regency
title_full Determinant Of Chronic Energy Deficiency (Kek) In Pregnant Women In The Working Area Of Siak Hulu Iii Health Center Of Kampar Regency
title_fullStr Determinant Of Chronic Energy Deficiency (Kek) In Pregnant Women In The Working Area Of Siak Hulu Iii Health Center Of Kampar Regency
title_full_unstemmed Determinant Of Chronic Energy Deficiency (Kek) In Pregnant Women In The Working Area Of Siak Hulu Iii Health Center Of Kampar Regency
title_sort determinant of chronic energy deficiency (kek) in pregnant women in the working area of siak hulu iii health center of kampar regency
publisher STIKes Hang Tuah Pekanbaru
series Jurnal Kesehatan Komunitas (Journal of Community Health)
issn 2088-7612
2548-8538
publishDate 2021-04-01
description Chronic Energy Deficiency (CED) pregnant women is a situation where a pregnant woman experiences nutritional deficiencies (calories and protein) that have long or chronic competition. In 2018, national the prevalence of CED in pregnant women is 17,3%, and the Siak Health Center prevalence of CED deficiency in pregnant women was 21,4%. The purpose of this research was to determine the factors that influence the CED in pregnant women in the working area of the Siak Hulu III Health Center of Kampar district. The method of this research was a descriptive quantitative analytical study with a cross-sectional design. The sample was 70 respondents in the working area Puskesmas Siak Hulu III. The sampling technique was consecutive sampling with the dependent variable, namely pregnant women with CED if the upper circumference <23,5 cm, and the dependent variable was knowledge, infectious disease, family income, parity, and hyperemesis gravidarum. The data analysis was a bivariate analysis with the Chi-Square test. The instrument used questionnaires and data processing using computerized. The results showed a correlation between knowledge on pregnant women CED (p-value 0,158 OR = 2,602), the influence of infectious diseases on pregnant women CED (p-value 0,003 OR = 5,881), family income (p-value 0,025 OR = 0,231), parity) (p-value 0,025 OR = 4,333), and hyperemesis gravidarum (p-value 0,017 OR = 3,934). It can be concluded that there is an influence between infectious disease, family income, parity, hyperemesis gravidarum, and health workers, in particular, are expected to be able to provide information.  
url https://jurnal.htp.ac.id/index.php/keskom/article/view/775
work_keys_str_mv AT sintiasintia determinantofchronicenergydeficiencykekinpregnantwomenintheworkingareaofsiakhuluiiihealthcenterofkamparregency
AT windaseptiani determinantofchronicenergydeficiencykekinpregnantwomenintheworkingareaofsiakhuluiiihealthcenterofkamparregency
AT novitarany determinantofchronicenergydeficiencykekinpregnantwomenintheworkingareaofsiakhuluiiihealthcenterofkamparregency
AT elmiakursani determinantofchronicenergydeficiencykekinpregnantwomenintheworkingareaofsiakhuluiiihealthcenterofkamparregency
_version_ 1721442990561427456