Determinant Of Chronic Energy Deficiency (Kek) In Pregnant Women In The Working Area Of Siak Hulu Iii Health Center Of Kampar Regency
Chronic Energy Deficiency (CED) pregnant women is a situation where a pregnant woman experiences nutritional deficiencies (calories and protein) that have long or chronic competition. In 2018, national the prevalence of CED in pregnant women is 17,3%, and the Siak Health Center prevalence of CED de...
Main Authors: | , , , |
---|---|
Format: | Article |
Language: | Indonesian |
Published: |
STIKes Hang Tuah Pekanbaru
2021-04-01
|
Series: | Jurnal Kesehatan Komunitas (Journal of Community Health) |
Online Access: | https://jurnal.htp.ac.id/index.php/keskom/article/view/775 |
id |
doaj-46662812005743d6861c9da814152b99 |
---|---|
record_format |
Article |
spelling |
doaj-46662812005743d6861c9da814152b992021-05-12T13:33:19ZindSTIKes Hang Tuah PekanbaruJurnal Kesehatan Komunitas (Journal of Community Health)2088-76122548-85382021-04-017110.25311/keskom.Vol7.Iss1.775Determinant Of Chronic Energy Deficiency (Kek) In Pregnant Women In The Working Area Of Siak Hulu Iii Health Center Of Kampar RegencySintia Sintia0Winda Septiani1Novita Rany2Elmia Kursani3Program Studi Kesehatan Masyarakat, STIKes Hang Tuah PekanbaruProgram Studi Kesehatan Masyarakat, STIKes Hang Tuah PekanbaruProgram Studi Kesehatan Masyarakat, STIKes Hang Tuah PekanbaruProgram Studi Kesehatan Masyarakat, STIKes Hang Tuah Pekanbaru Chronic Energy Deficiency (CED) pregnant women is a situation where a pregnant woman experiences nutritional deficiencies (calories and protein) that have long or chronic competition. In 2018, national the prevalence of CED in pregnant women is 17,3%, and the Siak Health Center prevalence of CED deficiency in pregnant women was 21,4%. The purpose of this research was to determine the factors that influence the CED in pregnant women in the working area of the Siak Hulu III Health Center of Kampar district. The method of this research was a descriptive quantitative analytical study with a cross-sectional design. The sample was 70 respondents in the working area Puskesmas Siak Hulu III. The sampling technique was consecutive sampling with the dependent variable, namely pregnant women with CED if the upper circumference <23,5 cm, and the dependent variable was knowledge, infectious disease, family income, parity, and hyperemesis gravidarum. The data analysis was a bivariate analysis with the Chi-Square test. The instrument used questionnaires and data processing using computerized. The results showed a correlation between knowledge on pregnant women CED (p-value 0,158 OR = 2,602), the influence of infectious diseases on pregnant women CED (p-value 0,003 OR = 5,881), family income (p-value 0,025 OR = 0,231), parity) (p-value 0,025 OR = 4,333), and hyperemesis gravidarum (p-value 0,017 OR = 3,934). It can be concluded that there is an influence between infectious disease, family income, parity, hyperemesis gravidarum, and health workers, in particular, are expected to be able to provide information. https://jurnal.htp.ac.id/index.php/keskom/article/view/775 |
collection |
DOAJ |
language |
Indonesian |
format |
Article |
sources |
DOAJ |
author |
Sintia Sintia Winda Septiani Novita Rany Elmia Kursani |
spellingShingle |
Sintia Sintia Winda Septiani Novita Rany Elmia Kursani Determinant Of Chronic Energy Deficiency (Kek) In Pregnant Women In The Working Area Of Siak Hulu Iii Health Center Of Kampar Regency Jurnal Kesehatan Komunitas (Journal of Community Health) |
author_facet |
Sintia Sintia Winda Septiani Novita Rany Elmia Kursani |
author_sort |
Sintia Sintia |
title |
Determinant Of Chronic Energy Deficiency (Kek) In Pregnant Women In The Working Area Of Siak Hulu Iii Health Center Of Kampar Regency |
title_short |
Determinant Of Chronic Energy Deficiency (Kek) In Pregnant Women In The Working Area Of Siak Hulu Iii Health Center Of Kampar Regency |
title_full |
Determinant Of Chronic Energy Deficiency (Kek) In Pregnant Women In The Working Area Of Siak Hulu Iii Health Center Of Kampar Regency |
title_fullStr |
Determinant Of Chronic Energy Deficiency (Kek) In Pregnant Women In The Working Area Of Siak Hulu Iii Health Center Of Kampar Regency |
title_full_unstemmed |
Determinant Of Chronic Energy Deficiency (Kek) In Pregnant Women In The Working Area Of Siak Hulu Iii Health Center Of Kampar Regency |
title_sort |
determinant of chronic energy deficiency (kek) in pregnant women in the working area of siak hulu iii health center of kampar regency |
publisher |
STIKes Hang Tuah Pekanbaru |
series |
Jurnal Kesehatan Komunitas (Journal of Community Health) |
issn |
2088-7612 2548-8538 |
publishDate |
2021-04-01 |
description |
Chronic Energy Deficiency (CED) pregnant women is a situation where a pregnant woman experiences nutritional deficiencies (calories and protein) that have long or chronic competition. In 2018, national the prevalence of CED in pregnant women is 17,3%, and the Siak Health Center prevalence of CED deficiency in pregnant women was 21,4%. The purpose of this research was to determine the factors that influence the CED in pregnant women in the working area of the Siak Hulu III Health Center of Kampar district. The method of this research was a descriptive quantitative analytical study with a cross-sectional design. The sample was 70 respondents in the working area Puskesmas Siak Hulu III. The sampling technique was consecutive sampling with the dependent variable, namely pregnant women with CED if the upper circumference <23,5 cm, and the dependent variable was knowledge, infectious disease, family income, parity, and hyperemesis gravidarum. The data analysis was a bivariate analysis with the Chi-Square test. The instrument used questionnaires and data processing using computerized. The results showed a correlation between knowledge on pregnant women CED (p-value 0,158 OR = 2,602), the influence of infectious diseases on pregnant women CED (p-value 0,003 OR = 5,881), family income (p-value 0,025 OR = 0,231), parity) (p-value 0,025 OR = 4,333), and hyperemesis gravidarum (p-value 0,017 OR = 3,934). It can be concluded that there is an influence between infectious disease, family income, parity, hyperemesis gravidarum, and health workers, in particular, are expected to be able to provide information.
|
url |
https://jurnal.htp.ac.id/index.php/keskom/article/view/775 |
work_keys_str_mv |
AT sintiasintia determinantofchronicenergydeficiencykekinpregnantwomenintheworkingareaofsiakhuluiiihealthcenterofkamparregency AT windaseptiani determinantofchronicenergydeficiencykekinpregnantwomenintheworkingareaofsiakhuluiiihealthcenterofkamparregency AT novitarany determinantofchronicenergydeficiencykekinpregnantwomenintheworkingareaofsiakhuluiiihealthcenterofkamparregency AT elmiakursani determinantofchronicenergydeficiencykekinpregnantwomenintheworkingareaofsiakhuluiiihealthcenterofkamparregency |
_version_ |
1721442990561427456 |