Experimental infections with Mycoplasma agalactiae identify key factors involved in host-colonization.

Mechanisms underlying pathogenic processes in mycoplasma infections are poorly understood, mainly because of limited sequence similarities with classical, bacterial virulence factors. Recently, large-scale transposon mutagenesis in the ruminant pathogen Mycoplasma agalactiae identified the NIF locus...

Full description

Bibliographic Details
Main Authors: Eric Baranowski, Dominique Bergonier, Eveline Sagné, Marie-Claude Hygonenq, Patricia Ronsin, Xavier Berthelot, Christine Citti
Format: Article
Language:English
Published: Public Library of Science (PLoS) 2014-01-01
Series:PLoS ONE
Online Access:http://europepmc.org/articles/PMC3974822?pdf=render
id doaj-4f65bc8a9e1047af869226d7648e5740
record_format Article
spelling doaj-4f65bc8a9e1047af869226d7648e57402020-11-24T21:36:25ZengPublic Library of Science (PLoS)PLoS ONE1932-62032014-01-0194e9397010.1371/journal.pone.0093970Experimental infections with Mycoplasma agalactiae identify key factors involved in host-colonization.Eric BaranowskiDominique BergonierEveline SagnéMarie-Claude HygonenqPatricia RonsinXavier BerthelotChristine CittiMechanisms underlying pathogenic processes in mycoplasma infections are poorly understood, mainly because of limited sequence similarities with classical, bacterial virulence factors. Recently, large-scale transposon mutagenesis in the ruminant pathogen Mycoplasma agalactiae identified the NIF locus, including nifS and nifU, as essential for mycoplasma growth in cell culture, while dispensable in axenic media. To evaluate the importance of this locus in vivo, the infectivity of two knock-out mutants was tested upon experimental infection in the natural host. In this model, the parental PG2 strain was able to establish a systemic infection in lactating ewes, colonizing various body sites such as lymph nodes and the mammary gland, even when inoculated at low doses. In these PG2-infected ewes, we observed over the course of infection (i) the development of a specific antibody response and (ii) dynamic changes in expression of M. agalactiae surface variable proteins (Vpma), with multiple Vpma profiles co-existing in the same animal. In contrast and despite a sensitive model, none of the knock-out mutants were able to survive and colonize the host. The extreme avirulent phenotype of the two mutants was further supported by the absence of an IgG response in inoculated animals. The exact role of the NIF locus remains to be elucidated but these data demonstrate that it plays a key role in the infectious process of M. agalactiae and most likely of other pathogenic mycoplasma species as many carry closely related homologs.http://europepmc.org/articles/PMC3974822?pdf=render
collection DOAJ
language English
format Article
sources DOAJ
author Eric Baranowski
Dominique Bergonier
Eveline Sagné
Marie-Claude Hygonenq
Patricia Ronsin
Xavier Berthelot
Christine Citti
spellingShingle Eric Baranowski
Dominique Bergonier
Eveline Sagné
Marie-Claude Hygonenq
Patricia Ronsin
Xavier Berthelot
Christine Citti
Experimental infections with Mycoplasma agalactiae identify key factors involved in host-colonization.
PLoS ONE
author_facet Eric Baranowski
Dominique Bergonier
Eveline Sagné
Marie-Claude Hygonenq
Patricia Ronsin
Xavier Berthelot
Christine Citti
author_sort Eric Baranowski
title Experimental infections with Mycoplasma agalactiae identify key factors involved in host-colonization.
title_short Experimental infections with Mycoplasma agalactiae identify key factors involved in host-colonization.
title_full Experimental infections with Mycoplasma agalactiae identify key factors involved in host-colonization.
title_fullStr Experimental infections with Mycoplasma agalactiae identify key factors involved in host-colonization.
title_full_unstemmed Experimental infections with Mycoplasma agalactiae identify key factors involved in host-colonization.
title_sort experimental infections with mycoplasma agalactiae identify key factors involved in host-colonization.
publisher Public Library of Science (PLoS)
series PLoS ONE
issn 1932-6203
publishDate 2014-01-01
description Mechanisms underlying pathogenic processes in mycoplasma infections are poorly understood, mainly because of limited sequence similarities with classical, bacterial virulence factors. Recently, large-scale transposon mutagenesis in the ruminant pathogen Mycoplasma agalactiae identified the NIF locus, including nifS and nifU, as essential for mycoplasma growth in cell culture, while dispensable in axenic media. To evaluate the importance of this locus in vivo, the infectivity of two knock-out mutants was tested upon experimental infection in the natural host. In this model, the parental PG2 strain was able to establish a systemic infection in lactating ewes, colonizing various body sites such as lymph nodes and the mammary gland, even when inoculated at low doses. In these PG2-infected ewes, we observed over the course of infection (i) the development of a specific antibody response and (ii) dynamic changes in expression of M. agalactiae surface variable proteins (Vpma), with multiple Vpma profiles co-existing in the same animal. In contrast and despite a sensitive model, none of the knock-out mutants were able to survive and colonize the host. The extreme avirulent phenotype of the two mutants was further supported by the absence of an IgG response in inoculated animals. The exact role of the NIF locus remains to be elucidated but these data demonstrate that it plays a key role in the infectious process of M. agalactiae and most likely of other pathogenic mycoplasma species as many carry closely related homologs.
url http://europepmc.org/articles/PMC3974822?pdf=render
work_keys_str_mv AT ericbaranowski experimentalinfectionswithmycoplasmaagalactiaeidentifykeyfactorsinvolvedinhostcolonization
AT dominiquebergonier experimentalinfectionswithmycoplasmaagalactiaeidentifykeyfactorsinvolvedinhostcolonization
AT evelinesagne experimentalinfectionswithmycoplasmaagalactiaeidentifykeyfactorsinvolvedinhostcolonization
AT marieclaudehygonenq experimentalinfectionswithmycoplasmaagalactiaeidentifykeyfactorsinvolvedinhostcolonization
AT patriciaronsin experimentalinfectionswithmycoplasmaagalactiaeidentifykeyfactorsinvolvedinhostcolonization
AT xavierberthelot experimentalinfectionswithmycoplasmaagalactiaeidentifykeyfactorsinvolvedinhostcolonization
AT christinecitti experimentalinfectionswithmycoplasmaagalactiaeidentifykeyfactorsinvolvedinhostcolonization
_version_ 1725941170211651584