Livedoid vasculopathy with mononeuritis multiplex associated with protein S deficiency mimicking systemic vasculitis

A 34-year-old female presented with recurrent ulcers over the bilateral lower limbs with mononeuritis multiplex. Possibilities considered were small-to-medium vessel vasculitis and vasculopathy. Skin biopsy was suggestive of livedoid vasculopathy (LV). Investigations revealed protein S deficiency. T...

Full description

Bibliographic Details
Main Authors: Vikramraj K Jain, Krishnamurthy Hegde, Renuka Panchagnula
Format: Article
Language:English
Published: Wolters Kluwer Medknow Publications 2019-01-01
Series:Indian Journal of Rheumatology
Subjects:
Online Access:http://www.indianjrheumatol.com/article.asp?issn=0973-3698;year=2019;volume=14;issue=1;spage=69;epage=73;aulast=Jain
id doaj-75a2e0fa68c245bc9c75352e82ba3638
record_format Article
spelling doaj-75a2e0fa68c245bc9c75352e82ba36382020-11-25T02:29:39ZengWolters Kluwer Medknow PublicationsIndian Journal of Rheumatology0973-36980973-37012019-01-01141697310.4103/injr.injr_97_18Livedoid vasculopathy with mononeuritis multiplex associated with protein S deficiency mimicking systemic vasculitisVikramraj K JainKrishnamurthy HegdeRenuka PanchagnulaA 34-year-old female presented with recurrent ulcers over the bilateral lower limbs with mononeuritis multiplex. Possibilities considered were small-to-medium vessel vasculitis and vasculopathy. Skin biopsy was suggestive of livedoid vasculopathy (LV). Investigations revealed protein S deficiency. The patient was treated with anticoagulation and immunosuppression after which her symptoms improved. LV can be associated with thrombophilias, fibrinolytic disorders, autoimmune diseases, and malignancy. Polyarteritis nodosa closely mimics the disease and needs a deep dermal biopsy to differentiate.http://www.indianjrheumatol.com/article.asp?issn=0973-3698;year=2019;volume=14;issue=1;spage=69;epage=73;aulast=JainLivedoidpolyarteritis nodosaprotein S deficiencyvasculopathy
collection DOAJ
language English
format Article
sources DOAJ
author Vikramraj K Jain
Krishnamurthy Hegde
Renuka Panchagnula
spellingShingle Vikramraj K Jain
Krishnamurthy Hegde
Renuka Panchagnula
Livedoid vasculopathy with mononeuritis multiplex associated with protein S deficiency mimicking systemic vasculitis
Indian Journal of Rheumatology
Livedoid
polyarteritis nodosa
protein S deficiency
vasculopathy
author_facet Vikramraj K Jain
Krishnamurthy Hegde
Renuka Panchagnula
author_sort Vikramraj K Jain
title Livedoid vasculopathy with mononeuritis multiplex associated with protein S deficiency mimicking systemic vasculitis
title_short Livedoid vasculopathy with mononeuritis multiplex associated with protein S deficiency mimicking systemic vasculitis
title_full Livedoid vasculopathy with mononeuritis multiplex associated with protein S deficiency mimicking systemic vasculitis
title_fullStr Livedoid vasculopathy with mononeuritis multiplex associated with protein S deficiency mimicking systemic vasculitis
title_full_unstemmed Livedoid vasculopathy with mononeuritis multiplex associated with protein S deficiency mimicking systemic vasculitis
title_sort livedoid vasculopathy with mononeuritis multiplex associated with protein s deficiency mimicking systemic vasculitis
publisher Wolters Kluwer Medknow Publications
series Indian Journal of Rheumatology
issn 0973-3698
0973-3701
publishDate 2019-01-01
description A 34-year-old female presented with recurrent ulcers over the bilateral lower limbs with mononeuritis multiplex. Possibilities considered were small-to-medium vessel vasculitis and vasculopathy. Skin biopsy was suggestive of livedoid vasculopathy (LV). Investigations revealed protein S deficiency. The patient was treated with anticoagulation and immunosuppression after which her symptoms improved. LV can be associated with thrombophilias, fibrinolytic disorders, autoimmune diseases, and malignancy. Polyarteritis nodosa closely mimics the disease and needs a deep dermal biopsy to differentiate.
topic Livedoid
polyarteritis nodosa
protein S deficiency
vasculopathy
url http://www.indianjrheumatol.com/article.asp?issn=0973-3698;year=2019;volume=14;issue=1;spage=69;epage=73;aulast=Jain
work_keys_str_mv AT vikramrajkjain livedoidvasculopathywithmononeuritismultiplexassociatedwithproteinsdeficiencymimickingsystemicvasculitis
AT krishnamurthyhegde livedoidvasculopathywithmononeuritismultiplexassociatedwithproteinsdeficiencymimickingsystemicvasculitis
AT renukapanchagnula livedoidvasculopathywithmononeuritismultiplexassociatedwithproteinsdeficiencymimickingsystemicvasculitis
_version_ 1724831733366390784