Livedoid vasculopathy with mononeuritis multiplex associated with protein S deficiency mimicking systemic vasculitis
A 34-year-old female presented with recurrent ulcers over the bilateral lower limbs with mononeuritis multiplex. Possibilities considered were small-to-medium vessel vasculitis and vasculopathy. Skin biopsy was suggestive of livedoid vasculopathy (LV). Investigations revealed protein S deficiency. T...
Main Authors: | , , |
---|---|
Format: | Article |
Language: | English |
Published: |
Wolters Kluwer Medknow Publications
2019-01-01
|
Series: | Indian Journal of Rheumatology |
Subjects: | |
Online Access: | http://www.indianjrheumatol.com/article.asp?issn=0973-3698;year=2019;volume=14;issue=1;spage=69;epage=73;aulast=Jain |
id |
doaj-75a2e0fa68c245bc9c75352e82ba3638 |
---|---|
record_format |
Article |
spelling |
doaj-75a2e0fa68c245bc9c75352e82ba36382020-11-25T02:29:39ZengWolters Kluwer Medknow PublicationsIndian Journal of Rheumatology0973-36980973-37012019-01-01141697310.4103/injr.injr_97_18Livedoid vasculopathy with mononeuritis multiplex associated with protein S deficiency mimicking systemic vasculitisVikramraj K JainKrishnamurthy HegdeRenuka PanchagnulaA 34-year-old female presented with recurrent ulcers over the bilateral lower limbs with mononeuritis multiplex. Possibilities considered were small-to-medium vessel vasculitis and vasculopathy. Skin biopsy was suggestive of livedoid vasculopathy (LV). Investigations revealed protein S deficiency. The patient was treated with anticoagulation and immunosuppression after which her symptoms improved. LV can be associated with thrombophilias, fibrinolytic disorders, autoimmune diseases, and malignancy. Polyarteritis nodosa closely mimics the disease and needs a deep dermal biopsy to differentiate.http://www.indianjrheumatol.com/article.asp?issn=0973-3698;year=2019;volume=14;issue=1;spage=69;epage=73;aulast=JainLivedoidpolyarteritis nodosaprotein S deficiencyvasculopathy |
collection |
DOAJ |
language |
English |
format |
Article |
sources |
DOAJ |
author |
Vikramraj K Jain Krishnamurthy Hegde Renuka Panchagnula |
spellingShingle |
Vikramraj K Jain Krishnamurthy Hegde Renuka Panchagnula Livedoid vasculopathy with mononeuritis multiplex associated with protein S deficiency mimicking systemic vasculitis Indian Journal of Rheumatology Livedoid polyarteritis nodosa protein S deficiency vasculopathy |
author_facet |
Vikramraj K Jain Krishnamurthy Hegde Renuka Panchagnula |
author_sort |
Vikramraj K Jain |
title |
Livedoid vasculopathy with mononeuritis multiplex associated with protein S deficiency mimicking systemic vasculitis |
title_short |
Livedoid vasculopathy with mononeuritis multiplex associated with protein S deficiency mimicking systemic vasculitis |
title_full |
Livedoid vasculopathy with mononeuritis multiplex associated with protein S deficiency mimicking systemic vasculitis |
title_fullStr |
Livedoid vasculopathy with mononeuritis multiplex associated with protein S deficiency mimicking systemic vasculitis |
title_full_unstemmed |
Livedoid vasculopathy with mononeuritis multiplex associated with protein S deficiency mimicking systemic vasculitis |
title_sort |
livedoid vasculopathy with mononeuritis multiplex associated with protein s deficiency mimicking systemic vasculitis |
publisher |
Wolters Kluwer Medknow Publications |
series |
Indian Journal of Rheumatology |
issn |
0973-3698 0973-3701 |
publishDate |
2019-01-01 |
description |
A 34-year-old female presented with recurrent ulcers over the bilateral lower limbs with mononeuritis multiplex. Possibilities considered were small-to-medium vessel vasculitis and vasculopathy. Skin biopsy was suggestive of livedoid vasculopathy (LV). Investigations revealed protein S deficiency. The patient was treated with anticoagulation and immunosuppression after which her symptoms improved. LV can be associated with thrombophilias, fibrinolytic disorders, autoimmune diseases, and malignancy. Polyarteritis nodosa closely mimics the disease and needs a deep dermal biopsy to differentiate. |
topic |
Livedoid polyarteritis nodosa protein S deficiency vasculopathy |
url |
http://www.indianjrheumatol.com/article.asp?issn=0973-3698;year=2019;volume=14;issue=1;spage=69;epage=73;aulast=Jain |
work_keys_str_mv |
AT vikramrajkjain livedoidvasculopathywithmononeuritismultiplexassociatedwithproteinsdeficiencymimickingsystemicvasculitis AT krishnamurthyhegde livedoidvasculopathywithmononeuritismultiplexassociatedwithproteinsdeficiencymimickingsystemicvasculitis AT renukapanchagnula livedoidvasculopathywithmononeuritismultiplexassociatedwithproteinsdeficiencymimickingsystemicvasculitis |
_version_ |
1724831733366390784 |