Pathway-, layer- and cell-type-specific thalamic input to mouse barrel cortex
Mouse primary somatosensory barrel cortex (wS1) processes whisker sensory information, receiving input from two distinct thalamic nuclei. The first-order ventral posterior medial (VPM) somatosensory thalamic nucleus most densely innervates layer 4 (L4) barrels, whereas the higher-order posterior tha...
Main Authors: | , , , , , , , |
---|---|
Format: | Article |
Language: | English |
Published: |
eLife Sciences Publications Ltd
2019-12-01
|
Series: | eLife |
Subjects: | |
Online Access: | https://elifesciences.org/articles/52665 |
id |
doaj-7bde516b68b54f6b939fa65cf568117e |
---|---|
record_format |
Article |
spelling |
doaj-7bde516b68b54f6b939fa65cf568117e2021-05-05T18:12:17ZengeLife Sciences Publications LtdeLife2050-084X2019-12-01810.7554/eLife.52665Pathway-, layer- and cell-type-specific thalamic input to mouse barrel cortexB Semihcan Sermet0Pavel Truschow1Michael Feyerabend2Johannes M Mayrhofer3Tess B Oram4Ofer Yizhar5https://orcid.org/0000-0003-4228-1448Jochen F Staiger6Carl CH Petersen7https://orcid.org/0000-0003-3344-4495Laboratory of Sensory Processing, Brain Mind Institute, Faculty of Life Sciences, Ecole Polytechnique Fédérale de Lausanne (EPFL), Lausanne, SwitzerlandInstitute for Neuroanatomy,University Medical Center, Georg-August-University Goettingen, Goettingen, GermanyInstitute for Neuroanatomy,University Medical Center, Georg-August-University Goettingen, Goettingen, GermanyLaboratory of Sensory Processing, Brain Mind Institute, Faculty of Life Sciences, Ecole Polytechnique Fédérale de Lausanne (EPFL), Lausanne, SwitzerlandDepartment of Neurobiology, Weizmann Institute of Science, Rehovot, IsraelDepartment of Neurobiology, Weizmann Institute of Science, Rehovot, IsraelInstitute for Neuroanatomy,University Medical Center, Georg-August-University Goettingen, Goettingen, GermanyLaboratory of Sensory Processing, Brain Mind Institute, Faculty of Life Sciences, Ecole Polytechnique Fédérale de Lausanne (EPFL), Lausanne, SwitzerlandMouse primary somatosensory barrel cortex (wS1) processes whisker sensory information, receiving input from two distinct thalamic nuclei. The first-order ventral posterior medial (VPM) somatosensory thalamic nucleus most densely innervates layer 4 (L4) barrels, whereas the higher-order posterior thalamic nucleus (medial part, POm) most densely innervates L1 and L5A. We optogenetically stimulated VPM or POm axons, and recorded evoked excitatory postsynaptic potentials (EPSPs) in different cell-types across cortical layers in wS1. We found that excitatory neurons and parvalbumin-expressing inhibitory neurons received the largest EPSPs, dominated by VPM input to L4 and POm input to L5A. In contrast, somatostatin-expressing inhibitory neurons received very little input from either pathway in any layer. Vasoactive intestinal peptide-expressing inhibitory neurons received an intermediate level of excitatory input with less apparent layer-specificity. Our data help understand how wS1 neocortical microcircuits might process and integrate sensory and higher-order inputs.https://elifesciences.org/articles/52665thalamuscortexcell-typeslayersEPSPs |
collection |
DOAJ |
language |
English |
format |
Article |
sources |
DOAJ |
author |
B Semihcan Sermet Pavel Truschow Michael Feyerabend Johannes M Mayrhofer Tess B Oram Ofer Yizhar Jochen F Staiger Carl CH Petersen |
spellingShingle |
B Semihcan Sermet Pavel Truschow Michael Feyerabend Johannes M Mayrhofer Tess B Oram Ofer Yizhar Jochen F Staiger Carl CH Petersen Pathway-, layer- and cell-type-specific thalamic input to mouse barrel cortex eLife thalamus cortex cell-types layers EPSPs |
author_facet |
B Semihcan Sermet Pavel Truschow Michael Feyerabend Johannes M Mayrhofer Tess B Oram Ofer Yizhar Jochen F Staiger Carl CH Petersen |
author_sort |
B Semihcan Sermet |
title |
Pathway-, layer- and cell-type-specific thalamic input to mouse barrel cortex |
title_short |
Pathway-, layer- and cell-type-specific thalamic input to mouse barrel cortex |
title_full |
Pathway-, layer- and cell-type-specific thalamic input to mouse barrel cortex |
title_fullStr |
Pathway-, layer- and cell-type-specific thalamic input to mouse barrel cortex |
title_full_unstemmed |
Pathway-, layer- and cell-type-specific thalamic input to mouse barrel cortex |
title_sort |
pathway-, layer- and cell-type-specific thalamic input to mouse barrel cortex |
publisher |
eLife Sciences Publications Ltd |
series |
eLife |
issn |
2050-084X |
publishDate |
2019-12-01 |
description |
Mouse primary somatosensory barrel cortex (wS1) processes whisker sensory information, receiving input from two distinct thalamic nuclei. The first-order ventral posterior medial (VPM) somatosensory thalamic nucleus most densely innervates layer 4 (L4) barrels, whereas the higher-order posterior thalamic nucleus (medial part, POm) most densely innervates L1 and L5A. We optogenetically stimulated VPM or POm axons, and recorded evoked excitatory postsynaptic potentials (EPSPs) in different cell-types across cortical layers in wS1. We found that excitatory neurons and parvalbumin-expressing inhibitory neurons received the largest EPSPs, dominated by VPM input to L4 and POm input to L5A. In contrast, somatostatin-expressing inhibitory neurons received very little input from either pathway in any layer. Vasoactive intestinal peptide-expressing inhibitory neurons received an intermediate level of excitatory input with less apparent layer-specificity. Our data help understand how wS1 neocortical microcircuits might process and integrate sensory and higher-order inputs. |
topic |
thalamus cortex cell-types layers EPSPs |
url |
https://elifesciences.org/articles/52665 |
work_keys_str_mv |
AT bsemihcansermet pathwaylayerandcelltypespecificthalamicinputtomousebarrelcortex AT paveltruschow pathwaylayerandcelltypespecificthalamicinputtomousebarrelcortex AT michaelfeyerabend pathwaylayerandcelltypespecificthalamicinputtomousebarrelcortex AT johannesmmayrhofer pathwaylayerandcelltypespecificthalamicinputtomousebarrelcortex AT tessboram pathwaylayerandcelltypespecificthalamicinputtomousebarrelcortex AT oferyizhar pathwaylayerandcelltypespecificthalamicinputtomousebarrelcortex AT jochenfstaiger pathwaylayerandcelltypespecificthalamicinputtomousebarrelcortex AT carlchpetersen pathwaylayerandcelltypespecificthalamicinputtomousebarrelcortex |
_version_ |
1721458749738057728 |