Genome-Wide Analysis of Chemosensory Protein Genes (CSPs) Family in Fig Wasps (Hymenoptera, Chalcidoidea)

Chemosensory proteins (CSP) are a class of acidic soluble proteins which have various functions in chemoreception, resistance and immunity, but we still have very little knowledge on this gene family in fig wasps, a peculiar insects group (Hymenoptera, Chalcidoidea) that shelter in the fig syconia o...

Full description

Bibliographic Details
Main Authors: Zhaozhe Xin, Dawei Huang, Dan Zhao, Jiaxing Li, Xianqin Wei, Jinhua Xiao
Format: Article
Language:English
Published: MDPI AG 2020-09-01
Series:Genes
Subjects:
Online Access:https://www.mdpi.com/2073-4425/11/10/1149
id doaj-7cd3bead9e9141d284529809bb89efef
record_format Article
spelling doaj-7cd3bead9e9141d284529809bb89efef2020-11-25T01:38:56ZengMDPI AGGenes2073-44252020-09-01111149114910.3390/genes11101149Genome-Wide Analysis of Chemosensory Protein Genes (CSPs) Family in Fig Wasps (Hymenoptera, Chalcidoidea)Zhaozhe Xin0Dawei Huang1Dan Zhao2Jiaxing Li3Xianqin Wei4Jinhua Xiao5Institute of Entomology, College of Life Sciences, Nankai University, Tianjin 300071, ChinaInstitute of Entomology, College of Life Sciences, Nankai University, Tianjin 300071, ChinaInstitute of Entomology, College of Life Sciences, Nankai University, Tianjin 300071, ChinaInstitute of Entomology, College of Life Sciences, Nankai University, Tianjin 300071, ChinaInstitute of Entomology, College of Life Sciences, Nankai University, Tianjin 300071, ChinaInstitute of Entomology, College of Life Sciences, Nankai University, Tianjin 300071, ChinaChemosensory proteins (CSP) are a class of acidic soluble proteins which have various functions in chemoreception, resistance and immunity, but we still have very little knowledge on this gene family in fig wasps, a peculiar insects group (Hymenoptera, Chalcidoidea) that shelter in the fig syconia of <i>Ficus</i> trees. Here, we made the first comprehensive analysis of CSP gene family in the 11 fig wasps at whole-genome level. We manually annotated 104 CSP genes in the genomes of the 11 fig wasps, comprehensively analyzed them in gene characteristics, conserved cysteine patterns, motif orders, phylogeny, genome distribution, gene tandem duplication, and expansion and contraction patterns of the gene family. We also approximately predicted the gene expression by codon adaptation index analysis. Our study shows that the CSP gene family is conserved in the 11 fig wasps; the CSP gene numbers in pollinating fig wasps are less than in non-pollinating fig wasps, which may be due to their longer history of adaptation to fig syconia; the expansion of CSP gene in two non-pollinating fig wasps, <i>Philotrypesis tridentata</i> and <i>Sycophaga agraensis</i>, may be a species-specific phenomenon. These results provide us with useful information for understanding the evolution of the CSP gene family of insects in diverse living environments.https://www.mdpi.com/2073-4425/11/10/1149chemosensory proteinsfig waspswhole-genome level
collection DOAJ
language English
format Article
sources DOAJ
author Zhaozhe Xin
Dawei Huang
Dan Zhao
Jiaxing Li
Xianqin Wei
Jinhua Xiao
spellingShingle Zhaozhe Xin
Dawei Huang
Dan Zhao
Jiaxing Li
Xianqin Wei
Jinhua Xiao
Genome-Wide Analysis of Chemosensory Protein Genes (CSPs) Family in Fig Wasps (Hymenoptera, Chalcidoidea)
Genes
chemosensory proteins
fig wasps
whole-genome level
author_facet Zhaozhe Xin
Dawei Huang
Dan Zhao
Jiaxing Li
Xianqin Wei
Jinhua Xiao
author_sort Zhaozhe Xin
title Genome-Wide Analysis of Chemosensory Protein Genes (CSPs) Family in Fig Wasps (Hymenoptera, Chalcidoidea)
title_short Genome-Wide Analysis of Chemosensory Protein Genes (CSPs) Family in Fig Wasps (Hymenoptera, Chalcidoidea)
title_full Genome-Wide Analysis of Chemosensory Protein Genes (CSPs) Family in Fig Wasps (Hymenoptera, Chalcidoidea)
title_fullStr Genome-Wide Analysis of Chemosensory Protein Genes (CSPs) Family in Fig Wasps (Hymenoptera, Chalcidoidea)
title_full_unstemmed Genome-Wide Analysis of Chemosensory Protein Genes (CSPs) Family in Fig Wasps (Hymenoptera, Chalcidoidea)
title_sort genome-wide analysis of chemosensory protein genes (csps) family in fig wasps (hymenoptera, chalcidoidea)
publisher MDPI AG
series Genes
issn 2073-4425
publishDate 2020-09-01
description Chemosensory proteins (CSP) are a class of acidic soluble proteins which have various functions in chemoreception, resistance and immunity, but we still have very little knowledge on this gene family in fig wasps, a peculiar insects group (Hymenoptera, Chalcidoidea) that shelter in the fig syconia of <i>Ficus</i> trees. Here, we made the first comprehensive analysis of CSP gene family in the 11 fig wasps at whole-genome level. We manually annotated 104 CSP genes in the genomes of the 11 fig wasps, comprehensively analyzed them in gene characteristics, conserved cysteine patterns, motif orders, phylogeny, genome distribution, gene tandem duplication, and expansion and contraction patterns of the gene family. We also approximately predicted the gene expression by codon adaptation index analysis. Our study shows that the CSP gene family is conserved in the 11 fig wasps; the CSP gene numbers in pollinating fig wasps are less than in non-pollinating fig wasps, which may be due to their longer history of adaptation to fig syconia; the expansion of CSP gene in two non-pollinating fig wasps, <i>Philotrypesis tridentata</i> and <i>Sycophaga agraensis</i>, may be a species-specific phenomenon. These results provide us with useful information for understanding the evolution of the CSP gene family of insects in diverse living environments.
topic chemosensory proteins
fig wasps
whole-genome level
url https://www.mdpi.com/2073-4425/11/10/1149
work_keys_str_mv AT zhaozhexin genomewideanalysisofchemosensoryproteingenescspsfamilyinfigwaspshymenopterachalcidoidea
AT daweihuang genomewideanalysisofchemosensoryproteingenescspsfamilyinfigwaspshymenopterachalcidoidea
AT danzhao genomewideanalysisofchemosensoryproteingenescspsfamilyinfigwaspshymenopterachalcidoidea
AT jiaxingli genomewideanalysisofchemosensoryproteingenescspsfamilyinfigwaspshymenopterachalcidoidea
AT xianqinwei genomewideanalysisofchemosensoryproteingenescspsfamilyinfigwaspshymenopterachalcidoidea
AT jinhuaxiao genomewideanalysisofchemosensoryproteingenescspsfamilyinfigwaspshymenopterachalcidoidea
_version_ 1725051361916092416