Genome-Wide Analysis of Chemosensory Protein Genes (CSPs) Family in Fig Wasps (Hymenoptera, Chalcidoidea)
Chemosensory proteins (CSP) are a class of acidic soluble proteins which have various functions in chemoreception, resistance and immunity, but we still have very little knowledge on this gene family in fig wasps, a peculiar insects group (Hymenoptera, Chalcidoidea) that shelter in the fig syconia o...
Main Authors: | , , , , , |
---|---|
Format: | Article |
Language: | English |
Published: |
MDPI AG
2020-09-01
|
Series: | Genes |
Subjects: | |
Online Access: | https://www.mdpi.com/2073-4425/11/10/1149 |
id |
doaj-7cd3bead9e9141d284529809bb89efef |
---|---|
record_format |
Article |
spelling |
doaj-7cd3bead9e9141d284529809bb89efef2020-11-25T01:38:56ZengMDPI AGGenes2073-44252020-09-01111149114910.3390/genes11101149Genome-Wide Analysis of Chemosensory Protein Genes (CSPs) Family in Fig Wasps (Hymenoptera, Chalcidoidea)Zhaozhe Xin0Dawei Huang1Dan Zhao2Jiaxing Li3Xianqin Wei4Jinhua Xiao5Institute of Entomology, College of Life Sciences, Nankai University, Tianjin 300071, ChinaInstitute of Entomology, College of Life Sciences, Nankai University, Tianjin 300071, ChinaInstitute of Entomology, College of Life Sciences, Nankai University, Tianjin 300071, ChinaInstitute of Entomology, College of Life Sciences, Nankai University, Tianjin 300071, ChinaInstitute of Entomology, College of Life Sciences, Nankai University, Tianjin 300071, ChinaInstitute of Entomology, College of Life Sciences, Nankai University, Tianjin 300071, ChinaChemosensory proteins (CSP) are a class of acidic soluble proteins which have various functions in chemoreception, resistance and immunity, but we still have very little knowledge on this gene family in fig wasps, a peculiar insects group (Hymenoptera, Chalcidoidea) that shelter in the fig syconia of <i>Ficus</i> trees. Here, we made the first comprehensive analysis of CSP gene family in the 11 fig wasps at whole-genome level. We manually annotated 104 CSP genes in the genomes of the 11 fig wasps, comprehensively analyzed them in gene characteristics, conserved cysteine patterns, motif orders, phylogeny, genome distribution, gene tandem duplication, and expansion and contraction patterns of the gene family. We also approximately predicted the gene expression by codon adaptation index analysis. Our study shows that the CSP gene family is conserved in the 11 fig wasps; the CSP gene numbers in pollinating fig wasps are less than in non-pollinating fig wasps, which may be due to their longer history of adaptation to fig syconia; the expansion of CSP gene in two non-pollinating fig wasps, <i>Philotrypesis tridentata</i> and <i>Sycophaga agraensis</i>, may be a species-specific phenomenon. These results provide us with useful information for understanding the evolution of the CSP gene family of insects in diverse living environments.https://www.mdpi.com/2073-4425/11/10/1149chemosensory proteinsfig waspswhole-genome level |
collection |
DOAJ |
language |
English |
format |
Article |
sources |
DOAJ |
author |
Zhaozhe Xin Dawei Huang Dan Zhao Jiaxing Li Xianqin Wei Jinhua Xiao |
spellingShingle |
Zhaozhe Xin Dawei Huang Dan Zhao Jiaxing Li Xianqin Wei Jinhua Xiao Genome-Wide Analysis of Chemosensory Protein Genes (CSPs) Family in Fig Wasps (Hymenoptera, Chalcidoidea) Genes chemosensory proteins fig wasps whole-genome level |
author_facet |
Zhaozhe Xin Dawei Huang Dan Zhao Jiaxing Li Xianqin Wei Jinhua Xiao |
author_sort |
Zhaozhe Xin |
title |
Genome-Wide Analysis of Chemosensory Protein Genes (CSPs) Family in Fig Wasps (Hymenoptera, Chalcidoidea) |
title_short |
Genome-Wide Analysis of Chemosensory Protein Genes (CSPs) Family in Fig Wasps (Hymenoptera, Chalcidoidea) |
title_full |
Genome-Wide Analysis of Chemosensory Protein Genes (CSPs) Family in Fig Wasps (Hymenoptera, Chalcidoidea) |
title_fullStr |
Genome-Wide Analysis of Chemosensory Protein Genes (CSPs) Family in Fig Wasps (Hymenoptera, Chalcidoidea) |
title_full_unstemmed |
Genome-Wide Analysis of Chemosensory Protein Genes (CSPs) Family in Fig Wasps (Hymenoptera, Chalcidoidea) |
title_sort |
genome-wide analysis of chemosensory protein genes (csps) family in fig wasps (hymenoptera, chalcidoidea) |
publisher |
MDPI AG |
series |
Genes |
issn |
2073-4425 |
publishDate |
2020-09-01 |
description |
Chemosensory proteins (CSP) are a class of acidic soluble proteins which have various functions in chemoreception, resistance and immunity, but we still have very little knowledge on this gene family in fig wasps, a peculiar insects group (Hymenoptera, Chalcidoidea) that shelter in the fig syconia of <i>Ficus</i> trees. Here, we made the first comprehensive analysis of CSP gene family in the 11 fig wasps at whole-genome level. We manually annotated 104 CSP genes in the genomes of the 11 fig wasps, comprehensively analyzed them in gene characteristics, conserved cysteine patterns, motif orders, phylogeny, genome distribution, gene tandem duplication, and expansion and contraction patterns of the gene family. We also approximately predicted the gene expression by codon adaptation index analysis. Our study shows that the CSP gene family is conserved in the 11 fig wasps; the CSP gene numbers in pollinating fig wasps are less than in non-pollinating fig wasps, which may be due to their longer history of adaptation to fig syconia; the expansion of CSP gene in two non-pollinating fig wasps, <i>Philotrypesis tridentata</i> and <i>Sycophaga agraensis</i>, may be a species-specific phenomenon. These results provide us with useful information for understanding the evolution of the CSP gene family of insects in diverse living environments. |
topic |
chemosensory proteins fig wasps whole-genome level |
url |
https://www.mdpi.com/2073-4425/11/10/1149 |
work_keys_str_mv |
AT zhaozhexin genomewideanalysisofchemosensoryproteingenescspsfamilyinfigwaspshymenopterachalcidoidea AT daweihuang genomewideanalysisofchemosensoryproteingenescspsfamilyinfigwaspshymenopterachalcidoidea AT danzhao genomewideanalysisofchemosensoryproteingenescspsfamilyinfigwaspshymenopterachalcidoidea AT jiaxingli genomewideanalysisofchemosensoryproteingenescspsfamilyinfigwaspshymenopterachalcidoidea AT xianqinwei genomewideanalysisofchemosensoryproteingenescspsfamilyinfigwaspshymenopterachalcidoidea AT jinhuaxiao genomewideanalysisofchemosensoryproteingenescspsfamilyinfigwaspshymenopterachalcidoidea |
_version_ |
1725051361916092416 |