Association between Plasma Leptin Level and Systemic Inflammatory Markers in Patients with Aggressive Periodontitis

Background: Increasing evidence supports an association between periodontitis and systemic diseases. Leptin is involved both in the energy metabolism and inflammatory processes and is suggested to be a link between periodontal infection and systemic health. The present study aimed to evaluate the pe...

Full description

Bibliographic Details
Main Authors: Dong Shi, Yun-Yu Liu, Wei Li, Xin Zhang, Xiao-Jun Sun, Li Xu, Li Zhang, Zhi-Bin Chen, Huan-Xin Meng
Format: Article
Language:English
Published: Wolters Kluwer 2015-01-01
Series:Chinese Medical Journal
Subjects:
Online Access:http://www.cmj.org/article.asp?issn=0366-6999;year=2015;volume=128;issue=4;spage=528;epage=532;aulast=Shi
id doaj-809c1e28ee6048349cd42ad59aadf3ae
record_format Article
spelling doaj-809c1e28ee6048349cd42ad59aadf3ae2020-11-25T02:11:56ZengWolters KluwerChinese Medical Journal0366-69992015-01-01128452853210.4103/0366-6999.151110Association between Plasma Leptin Level and Systemic Inflammatory Markers in Patients with Aggressive PeriodontitisDong ShiYun-Yu LiuWei LiXin ZhangXiao-Jun SunLi XuLi ZhangZhi-Bin ChenHuan-Xin MengBackground: Increasing evidence supports an association between periodontitis and systemic diseases. Leptin is involved both in the energy metabolism and inflammatory processes and is suggested to be a link between periodontal infection and systemic health. The present study aimed to evaluate the peripheral leptin concentration in patients with aggressive periodontitis (AgP) and to explore the relationship between leptin and systemic inflammation. Methods: Ninety patients with AgP visiting the Clinic of the Periodontology Department, Peking University School and Hospital of Stomatology between July 2001 and May 2006, and 44 healthy controls (staff and student volunteers in the same institute) were recruited. Plasma levels of leptin and inflammatory cytokines including interleukin (IL)-1β, IL-6, tumor necrosis factor-α (TNF-α) and C-reactive protein (CRP) were measured by enzyme-linked immunosorbent assay. Correlation and multiple linear regression analysis were performed to analyze the association between plasma leptin level and other variables. Results: Plasma leptin level of AgP group was significantly higher than that of the control group (19.7 ± 4.4 ng/ml vs. 7.5 ± 1.3 ng/ml, P < 0.01). After controlling for age, gender, and body mass index, positive correlation was observed between plasma leptin concentration and log-transformed levels of pro-inflammatory cytokines (IL-1β, IL-6, TNF-α and CRP), and the partial correlation coefficients ranged from 0.199 to 0.376 (P < 0.05). Log-transformed IL-1β and IL-6 levels entered the final regression model (standardized β were 0.422 and 0.461 respectively, P < 0.01). Conclusions: Elevated plasma leptin concentration may be associated with increased systemic levels of inflammatory markers in AgP patients.http://www.cmj.org/article.asp?issn=0366-6999;year=2015;volume=128;issue=4;spage=528;epage=532;aulast=ShiAggressive Periodontitis; Inflammation Mediators; Leptin
collection DOAJ
language English
format Article
sources DOAJ
author Dong Shi
Yun-Yu Liu
Wei Li
Xin Zhang
Xiao-Jun Sun
Li Xu
Li Zhang
Zhi-Bin Chen
Huan-Xin Meng
spellingShingle Dong Shi
Yun-Yu Liu
Wei Li
Xin Zhang
Xiao-Jun Sun
Li Xu
Li Zhang
Zhi-Bin Chen
Huan-Xin Meng
Association between Plasma Leptin Level and Systemic Inflammatory Markers in Patients with Aggressive Periodontitis
Chinese Medical Journal
Aggressive Periodontitis; Inflammation Mediators; Leptin
author_facet Dong Shi
Yun-Yu Liu
Wei Li
Xin Zhang
Xiao-Jun Sun
Li Xu
Li Zhang
Zhi-Bin Chen
Huan-Xin Meng
author_sort Dong Shi
title Association between Plasma Leptin Level and Systemic Inflammatory Markers in Patients with Aggressive Periodontitis
title_short Association between Plasma Leptin Level and Systemic Inflammatory Markers in Patients with Aggressive Periodontitis
title_full Association between Plasma Leptin Level and Systemic Inflammatory Markers in Patients with Aggressive Periodontitis
title_fullStr Association between Plasma Leptin Level and Systemic Inflammatory Markers in Patients with Aggressive Periodontitis
title_full_unstemmed Association between Plasma Leptin Level and Systemic Inflammatory Markers in Patients with Aggressive Periodontitis
title_sort association between plasma leptin level and systemic inflammatory markers in patients with aggressive periodontitis
publisher Wolters Kluwer
series Chinese Medical Journal
issn 0366-6999
publishDate 2015-01-01
description Background: Increasing evidence supports an association between periodontitis and systemic diseases. Leptin is involved both in the energy metabolism and inflammatory processes and is suggested to be a link between periodontal infection and systemic health. The present study aimed to evaluate the peripheral leptin concentration in patients with aggressive periodontitis (AgP) and to explore the relationship between leptin and systemic inflammation. Methods: Ninety patients with AgP visiting the Clinic of the Periodontology Department, Peking University School and Hospital of Stomatology between July 2001 and May 2006, and 44 healthy controls (staff and student volunteers in the same institute) were recruited. Plasma levels of leptin and inflammatory cytokines including interleukin (IL)-1β, IL-6, tumor necrosis factor-α (TNF-α) and C-reactive protein (CRP) were measured by enzyme-linked immunosorbent assay. Correlation and multiple linear regression analysis were performed to analyze the association between plasma leptin level and other variables. Results: Plasma leptin level of AgP group was significantly higher than that of the control group (19.7 ± 4.4 ng/ml vs. 7.5 ± 1.3 ng/ml, P < 0.01). After controlling for age, gender, and body mass index, positive correlation was observed between plasma leptin concentration and log-transformed levels of pro-inflammatory cytokines (IL-1β, IL-6, TNF-α and CRP), and the partial correlation coefficients ranged from 0.199 to 0.376 (P < 0.05). Log-transformed IL-1β and IL-6 levels entered the final regression model (standardized β were 0.422 and 0.461 respectively, P < 0.01). Conclusions: Elevated plasma leptin concentration may be associated with increased systemic levels of inflammatory markers in AgP patients.
topic Aggressive Periodontitis; Inflammation Mediators; Leptin
url http://www.cmj.org/article.asp?issn=0366-6999;year=2015;volume=128;issue=4;spage=528;epage=532;aulast=Shi
work_keys_str_mv AT dongshi associationbetweenplasmaleptinlevelandsystemicinflammatorymarkersinpatientswithaggressiveperiodontitis
AT yunyuliu associationbetweenplasmaleptinlevelandsystemicinflammatorymarkersinpatientswithaggressiveperiodontitis
AT weili associationbetweenplasmaleptinlevelandsystemicinflammatorymarkersinpatientswithaggressiveperiodontitis
AT xinzhang associationbetweenplasmaleptinlevelandsystemicinflammatorymarkersinpatientswithaggressiveperiodontitis
AT xiaojunsun associationbetweenplasmaleptinlevelandsystemicinflammatorymarkersinpatientswithaggressiveperiodontitis
AT lixu associationbetweenplasmaleptinlevelandsystemicinflammatorymarkersinpatientswithaggressiveperiodontitis
AT lizhang associationbetweenplasmaleptinlevelandsystemicinflammatorymarkersinpatientswithaggressiveperiodontitis
AT zhibinchen associationbetweenplasmaleptinlevelandsystemicinflammatorymarkersinpatientswithaggressiveperiodontitis
AT huanxinmeng associationbetweenplasmaleptinlevelandsystemicinflammatorymarkersinpatientswithaggressiveperiodontitis
_version_ 1724911811315105792