Genome-Wide Analysis, Expression Profile, and Characterization of the Acid Invertase Gene Family in Pepper
Catalytic decomposition of sucrose by acid invertases (AINVs) under acidic conditions plays an important role in the development of sink organs in plants. To reveal the function of AINVs in the development of pepper fruits, nine <i>AINV</i> genes of pepper were identified. Protein sequen...
Main Authors: | , , , , , , , , |
---|---|
Format: | Article |
Language: | English |
Published: |
MDPI AG
2018-12-01
|
Series: | International Journal of Molecular Sciences |
Subjects: | |
Online Access: | https://www.mdpi.com/1422-0067/20/1/15 |
id |
doaj-86d0cb1aceea43a4838b729a994a2b89 |
---|---|
record_format |
Article |
spelling |
doaj-86d0cb1aceea43a4838b729a994a2b892020-11-24T23:33:11ZengMDPI AGInternational Journal of Molecular Sciences1422-00672018-12-012011510.3390/ijms20010015ijms20010015Genome-Wide Analysis, Expression Profile, and Characterization of the Acid Invertase Gene Family in PepperLong-Bin Shen0Yu-Ling Qin1Zhi-Qiang Qi2Yu Niu3Zi-Ji Liu4Wei-Xia Liu5Huang He6Zhen-Mu Cao7Yan Yang8Tropical Crops Genetic Resources Institute, Chinese Academy of Tropical Agricultural Sciences/Key Laboratory of Crop Gene Resources and Germplasm Enhancement in Southern China, Ministry of Agriculture, Danzhou 571737, ChinaTropical Crops Genetic Resources Institute, Chinese Academy of Tropical Agricultural Sciences/Key Laboratory of Crop Gene Resources and Germplasm Enhancement in Southern China, Ministry of Agriculture, Danzhou 571737, ChinaTropical Crops Genetic Resources Institute, Chinese Academy of Tropical Agricultural Sciences/Key Laboratory of Crop Gene Resources and Germplasm Enhancement in Southern China, Ministry of Agriculture, Danzhou 571737, ChinaTropical Crops Genetic Resources Institute, Chinese Academy of Tropical Agricultural Sciences/Key Laboratory of Crop Gene Resources and Germplasm Enhancement in Southern China, Ministry of Agriculture, Danzhou 571737, ChinaTropical Crops Genetic Resources Institute, Chinese Academy of Tropical Agricultural Sciences/Key Laboratory of Crop Gene Resources and Germplasm Enhancement in Southern China, Ministry of Agriculture, Danzhou 571737, ChinaTropical Crops Genetic Resources Institute, Chinese Academy of Tropical Agricultural Sciences/Key Laboratory of Crop Gene Resources and Germplasm Enhancement in Southern China, Ministry of Agriculture, Danzhou 571737, ChinaTropical Crops Genetic Resources Institute, Chinese Academy of Tropical Agricultural Sciences/Key Laboratory of Crop Gene Resources and Germplasm Enhancement in Southern China, Ministry of Agriculture, Danzhou 571737, ChinaTropical Crops Genetic Resources Institute, Chinese Academy of Tropical Agricultural Sciences/Key Laboratory of Crop Gene Resources and Germplasm Enhancement in Southern China, Ministry of Agriculture, Danzhou 571737, ChinaTropical Crops Genetic Resources Institute, Chinese Academy of Tropical Agricultural Sciences/Key Laboratory of Crop Gene Resources and Germplasm Enhancement in Southern China, Ministry of Agriculture, Danzhou 571737, ChinaCatalytic decomposition of sucrose by acid invertases (AINVs) under acidic conditions plays an important role in the development of sink organs in plants. To reveal the function of AINVs in the development of pepper fruits, nine <i>AINV</i> genes of pepper were identified. Protein sequencing and phylogenetic analysis revealed that the CaAINV family may be divided into cell wall invertases (CaCWINV1⁻7) and vacuolar invertases (CaVINV1⁻2). CaAINVs contain conserved regions and protein structures typical of the AINVs in other plants. Gene expression profiling indicated that <i>CaCWINV2</i> and <i>CaVINV1</i> were highly expressed in reproductive organs but differed in expression pattern. <i>CaCWINV2</i> was mainly expressed in buds and flowers, while <i>CaVINV1</i> was expressed in developmental stages, such as the post-breaker stage. Furthermore, invertase activity of CaCWINV2 and CaVINV1 was identified via functional complementation in an invertase-deficient yeast. Optimum pH for CaCWINV2 and CaVINV1 was found to be 4.0 and 4.5, respectively. Gene expression and enzymatic activity of CaCWINV2 and CaVINV1 indicate that these AINV enzymes may be pivotal for sucrose hydrolysis in the reproductive organs of pepper.https://www.mdpi.com/1422-0067/20/1/15acid invertasepeppergene expressionenzymatic activity |
collection |
DOAJ |
language |
English |
format |
Article |
sources |
DOAJ |
author |
Long-Bin Shen Yu-Ling Qin Zhi-Qiang Qi Yu Niu Zi-Ji Liu Wei-Xia Liu Huang He Zhen-Mu Cao Yan Yang |
spellingShingle |
Long-Bin Shen Yu-Ling Qin Zhi-Qiang Qi Yu Niu Zi-Ji Liu Wei-Xia Liu Huang He Zhen-Mu Cao Yan Yang Genome-Wide Analysis, Expression Profile, and Characterization of the Acid Invertase Gene Family in Pepper International Journal of Molecular Sciences acid invertase pepper gene expression enzymatic activity |
author_facet |
Long-Bin Shen Yu-Ling Qin Zhi-Qiang Qi Yu Niu Zi-Ji Liu Wei-Xia Liu Huang He Zhen-Mu Cao Yan Yang |
author_sort |
Long-Bin Shen |
title |
Genome-Wide Analysis, Expression Profile, and Characterization of the Acid Invertase Gene Family in Pepper |
title_short |
Genome-Wide Analysis, Expression Profile, and Characterization of the Acid Invertase Gene Family in Pepper |
title_full |
Genome-Wide Analysis, Expression Profile, and Characterization of the Acid Invertase Gene Family in Pepper |
title_fullStr |
Genome-Wide Analysis, Expression Profile, and Characterization of the Acid Invertase Gene Family in Pepper |
title_full_unstemmed |
Genome-Wide Analysis, Expression Profile, and Characterization of the Acid Invertase Gene Family in Pepper |
title_sort |
genome-wide analysis, expression profile, and characterization of the acid invertase gene family in pepper |
publisher |
MDPI AG |
series |
International Journal of Molecular Sciences |
issn |
1422-0067 |
publishDate |
2018-12-01 |
description |
Catalytic decomposition of sucrose by acid invertases (AINVs) under acidic conditions plays an important role in the development of sink organs in plants. To reveal the function of AINVs in the development of pepper fruits, nine <i>AINV</i> genes of pepper were identified. Protein sequencing and phylogenetic analysis revealed that the CaAINV family may be divided into cell wall invertases (CaCWINV1⁻7) and vacuolar invertases (CaVINV1⁻2). CaAINVs contain conserved regions and protein structures typical of the AINVs in other plants. Gene expression profiling indicated that <i>CaCWINV2</i> and <i>CaVINV1</i> were highly expressed in reproductive organs but differed in expression pattern. <i>CaCWINV2</i> was mainly expressed in buds and flowers, while <i>CaVINV1</i> was expressed in developmental stages, such as the post-breaker stage. Furthermore, invertase activity of CaCWINV2 and CaVINV1 was identified via functional complementation in an invertase-deficient yeast. Optimum pH for CaCWINV2 and CaVINV1 was found to be 4.0 and 4.5, respectively. Gene expression and enzymatic activity of CaCWINV2 and CaVINV1 indicate that these AINV enzymes may be pivotal for sucrose hydrolysis in the reproductive organs of pepper. |
topic |
acid invertase pepper gene expression enzymatic activity |
url |
https://www.mdpi.com/1422-0067/20/1/15 |
work_keys_str_mv |
AT longbinshen genomewideanalysisexpressionprofileandcharacterizationoftheacidinvertasegenefamilyinpepper AT yulingqin genomewideanalysisexpressionprofileandcharacterizationoftheacidinvertasegenefamilyinpepper AT zhiqiangqi genomewideanalysisexpressionprofileandcharacterizationoftheacidinvertasegenefamilyinpepper AT yuniu genomewideanalysisexpressionprofileandcharacterizationoftheacidinvertasegenefamilyinpepper AT zijiliu genomewideanalysisexpressionprofileandcharacterizationoftheacidinvertasegenefamilyinpepper AT weixialiu genomewideanalysisexpressionprofileandcharacterizationoftheacidinvertasegenefamilyinpepper AT huanghe genomewideanalysisexpressionprofileandcharacterizationoftheacidinvertasegenefamilyinpepper AT zhenmucao genomewideanalysisexpressionprofileandcharacterizationoftheacidinvertasegenefamilyinpepper AT yanyang genomewideanalysisexpressionprofileandcharacterizationoftheacidinvertasegenefamilyinpepper |
_version_ |
1725531803190558720 |