PIMS-TS, the New Paediatric Systemic Inflammatory Disease Related to Previous Exposure to SARS-CoV-2 Infection—“Rheumatic Fever” of the 21st Century?

Paediatric inflammatory multisystem syndrome temporally associated with <i>severe acute respiratory syndrome coronavirus 2</i> (<i>SARS-CoV-2</i>) (PIMS-TS) is a new systemic inflammatory disease that mainly affects children. Its course in many features resembles that of acut...

Full description

Bibliographic Details
Main Authors: Violetta Opoka-Winiarska, Ewelina Grywalska, Jacek Roliński
Format: Article
Language:English
Published: MDPI AG 2021-04-01
Series:International Journal of Molecular Sciences
Subjects:
Online Access:https://www.mdpi.com/1422-0067/22/9/4488
id doaj-89e69b81317c4110ad2ceb77886399c3
record_format Article
spelling doaj-89e69b81317c4110ad2ceb77886399c32021-04-26T23:00:12ZengMDPI AGInternational Journal of Molecular Sciences1661-65961422-00672021-04-01224488448810.3390/ijms22094488PIMS-TS, the New Paediatric Systemic Inflammatory Disease Related to Previous Exposure to SARS-CoV-2 Infection—“Rheumatic Fever” of the 21st Century?Violetta Opoka-Winiarska0Ewelina Grywalska1Jacek Roliński2Department of Paediatric Pulmonology and Rheumatology, Medical University of Lublin, Gębali 6, 20-093 Lublin, PolandDepartment of Clinical Immunology and Immunotherapy, Medical University of Lublin, Chodzki 4a Street, 20-093 Lublin, PolandDepartment of Clinical Immunology and Immunotherapy, Medical University of Lublin, Chodzki 4a Street, 20-093 Lublin, PolandPaediatric inflammatory multisystem syndrome temporally associated with <i>severe acute respiratory syndrome coronavirus 2</i> (<i>SARS-CoV-2</i>) (PIMS-TS) is a new systemic inflammatory disease that mainly affects children. Its course in many features resembles that of acute rheumatic fever (ARF). Therefore, it is interesting that the experiences with ARF can be used in the management of patients with PIMS-TS. The aim of the article is to analyse the current data on PIMS-TS in relation to ARF. PIMS-TS and ARF are associated with an abnormal immune response to specific pathogens (<i>SARS-CoV-2</i> and group <i>A streptococcus</i>, respectively). The main symptoms of both diseases are fever and cardiac involvement. Current therapy for PIMS-TS is based on anti-inflammatory treatment: intravenous immunoglobulin (first-line), intravenous glucocorticoids (second-line), or biological therapy (third-line; including interleukin [IL]-1 antagonists, IL-6 receptor blockers, and anti-tumour necrosis factor agents). Vaccination might be good prophylaxis, but the efficacy and safety of the vaccines against <i>SARS-CoV-2</i> have not yet been established in children. Interesting insights may be gained by considering PIMS-TS in light of what is known of ARF due to their similar courses, but there are still many unanswered questions surrounding this disease and its pathogenesis.https://www.mdpi.com/1422-0067/22/9/4488COVID-19paediatric inflammatory multisystemic syndrome (PIMS)rheumatic fever
collection DOAJ
language English
format Article
sources DOAJ
author Violetta Opoka-Winiarska
Ewelina Grywalska
Jacek Roliński
spellingShingle Violetta Opoka-Winiarska
Ewelina Grywalska
Jacek Roliński
PIMS-TS, the New Paediatric Systemic Inflammatory Disease Related to Previous Exposure to SARS-CoV-2 Infection—“Rheumatic Fever” of the 21st Century?
International Journal of Molecular Sciences
COVID-19
paediatric inflammatory multisystemic syndrome (PIMS)
rheumatic fever
author_facet Violetta Opoka-Winiarska
Ewelina Grywalska
Jacek Roliński
author_sort Violetta Opoka-Winiarska
title PIMS-TS, the New Paediatric Systemic Inflammatory Disease Related to Previous Exposure to SARS-CoV-2 Infection—“Rheumatic Fever” of the 21st Century?
title_short PIMS-TS, the New Paediatric Systemic Inflammatory Disease Related to Previous Exposure to SARS-CoV-2 Infection—“Rheumatic Fever” of the 21st Century?
title_full PIMS-TS, the New Paediatric Systemic Inflammatory Disease Related to Previous Exposure to SARS-CoV-2 Infection—“Rheumatic Fever” of the 21st Century?
title_fullStr PIMS-TS, the New Paediatric Systemic Inflammatory Disease Related to Previous Exposure to SARS-CoV-2 Infection—“Rheumatic Fever” of the 21st Century?
title_full_unstemmed PIMS-TS, the New Paediatric Systemic Inflammatory Disease Related to Previous Exposure to SARS-CoV-2 Infection—“Rheumatic Fever” of the 21st Century?
title_sort pims-ts, the new paediatric systemic inflammatory disease related to previous exposure to sars-cov-2 infection—“rheumatic fever” of the 21st century?
publisher MDPI AG
series International Journal of Molecular Sciences
issn 1661-6596
1422-0067
publishDate 2021-04-01
description Paediatric inflammatory multisystem syndrome temporally associated with <i>severe acute respiratory syndrome coronavirus 2</i> (<i>SARS-CoV-2</i>) (PIMS-TS) is a new systemic inflammatory disease that mainly affects children. Its course in many features resembles that of acute rheumatic fever (ARF). Therefore, it is interesting that the experiences with ARF can be used in the management of patients with PIMS-TS. The aim of the article is to analyse the current data on PIMS-TS in relation to ARF. PIMS-TS and ARF are associated with an abnormal immune response to specific pathogens (<i>SARS-CoV-2</i> and group <i>A streptococcus</i>, respectively). The main symptoms of both diseases are fever and cardiac involvement. Current therapy for PIMS-TS is based on anti-inflammatory treatment: intravenous immunoglobulin (first-line), intravenous glucocorticoids (second-line), or biological therapy (third-line; including interleukin [IL]-1 antagonists, IL-6 receptor blockers, and anti-tumour necrosis factor agents). Vaccination might be good prophylaxis, but the efficacy and safety of the vaccines against <i>SARS-CoV-2</i> have not yet been established in children. Interesting insights may be gained by considering PIMS-TS in light of what is known of ARF due to their similar courses, but there are still many unanswered questions surrounding this disease and its pathogenesis.
topic COVID-19
paediatric inflammatory multisystemic syndrome (PIMS)
rheumatic fever
url https://www.mdpi.com/1422-0067/22/9/4488
work_keys_str_mv AT violettaopokawiniarska pimststhenewpaediatricsystemicinflammatorydiseaserelatedtopreviousexposuretosarscov2infectionrheumaticfeverofthe21stcentury
AT ewelinagrywalska pimststhenewpaediatricsystemicinflammatorydiseaserelatedtopreviousexposuretosarscov2infectionrheumaticfeverofthe21stcentury
AT jacekrolinski pimststhenewpaediatricsystemicinflammatorydiseaserelatedtopreviousexposuretosarscov2infectionrheumaticfeverofthe21stcentury
_version_ 1721507373876510720