Treatment modalities for coronavirus disease 2019 (COVID-19)

Management of coronavirus disease 2019 (COVID-19) infection is based on limited data and keeps changing rapidly as new clinical data emerge. Remdesivir has shown to reduce duration of hospital stay and has been approved for treatment. In RECOVERY trial, corticosteroids lowered 28-day mortality in p...

Full description

Bibliographic Details
Main Author: Panduranga G
Format: Article
Language:English
Published: KIMS Foundation and Research Center 2020-12-01
Series:Journal of Medical and Scientific Research
Subjects:
Online Access:http://jmsronline.com/article.aspx?ID=Treatment-modalities-for-coronavirus-disease-2019-COVID-19
id doaj-9f16e503880d4d83bc4dbc92bbd53cac
record_format Article
spelling doaj-9f16e503880d4d83bc4dbc92bbd53cac2021-06-05T11:42:03ZengKIMS Foundation and Research CenterJournal of Medical and Scientific Research2321-13262394-112X2020-12-018S110611110.17727/JMSR.2020/8S1-13Treatment modalities for coronavirus disease 2019 (COVID-19)Panduranga G0Department of Internal Medicine, Krishna Institute of Medical Sciences, Minister Road, Secunderabad-500003, Telangana, India Management of coronavirus disease 2019 (COVID-19) infection is based on limited data and keeps changing rapidly as new clinical data emerge. Remdesivir has shown to reduce duration of hospital stay and has been approved for treatment. In RECOVERY trial, corticosteroids lowered 28-day mortality in patients requiring oxygen supplementation or mechanical ventilation. Convalescent plasma did not live up to its initial promise and is not the standard of care for treatment at present. There’s not enough evidence for use of Hydroxychloroquine, Interleukin-6 inhibitors and many other investigational drugs. Bamlanivimab, casirivimab- imdevimab combo, all monoclonal antibodies, have recently been approved for use in mild to moderate COVIID-19, when there’s a high risk of progression to severe disease. Treatment of COVID-19 depends on stage and severity of disease. Antiviral medications are likely to be most effective when used early. Later in the disease, anti-inflammatory medications, anticoagulants and immunomodulators may be more effective. The world is waiting and hoping for a safe and effective vaccine which can put an end to this worldwide pandemic. http://jmsronline.com/article.aspx?ID=Treatment-modalities-for-coronavirus-disease-2019-COVID-19covid-19treatmentcoronavirus diseaseremdesivirfavipravirhydroxychloroquinecovid antibody therapies
collection DOAJ
language English
format Article
sources DOAJ
author Panduranga G
spellingShingle Panduranga G
Treatment modalities for coronavirus disease 2019 (COVID-19)
Journal of Medical and Scientific Research
covid-19
treatment
coronavirus disease
remdesivir
favipravir
hydroxychloroquine
covid antibody therapies
author_facet Panduranga G
author_sort Panduranga G
title Treatment modalities for coronavirus disease 2019 (COVID-19)
title_short Treatment modalities for coronavirus disease 2019 (COVID-19)
title_full Treatment modalities for coronavirus disease 2019 (COVID-19)
title_fullStr Treatment modalities for coronavirus disease 2019 (COVID-19)
title_full_unstemmed Treatment modalities for coronavirus disease 2019 (COVID-19)
title_sort treatment modalities for coronavirus disease 2019 (covid-19)
publisher KIMS Foundation and Research Center
series Journal of Medical and Scientific Research
issn 2321-1326
2394-112X
publishDate 2020-12-01
description Management of coronavirus disease 2019 (COVID-19) infection is based on limited data and keeps changing rapidly as new clinical data emerge. Remdesivir has shown to reduce duration of hospital stay and has been approved for treatment. In RECOVERY trial, corticosteroids lowered 28-day mortality in patients requiring oxygen supplementation or mechanical ventilation. Convalescent plasma did not live up to its initial promise and is not the standard of care for treatment at present. There’s not enough evidence for use of Hydroxychloroquine, Interleukin-6 inhibitors and many other investigational drugs. Bamlanivimab, casirivimab- imdevimab combo, all monoclonal antibodies, have recently been approved for use in mild to moderate COVIID-19, when there’s a high risk of progression to severe disease. Treatment of COVID-19 depends on stage and severity of disease. Antiviral medications are likely to be most effective when used early. Later in the disease, anti-inflammatory medications, anticoagulants and immunomodulators may be more effective. The world is waiting and hoping for a safe and effective vaccine which can put an end to this worldwide pandemic.
topic covid-19
treatment
coronavirus disease
remdesivir
favipravir
hydroxychloroquine
covid antibody therapies
url http://jmsronline.com/article.aspx?ID=Treatment-modalities-for-coronavirus-disease-2019-COVID-19
work_keys_str_mv AT pandurangag treatmentmodalitiesforcoronavirusdisease2019covid19
_version_ 1721396506617970688