Treatment modalities for coronavirus disease 2019 (COVID-19)
Management of coronavirus disease 2019 (COVID-19) infection is based on limited data and keeps changing rapidly as new clinical data emerge. Remdesivir has shown to reduce duration of hospital stay and has been approved for treatment. In RECOVERY trial, corticosteroids lowered 28-day mortality in p...
Main Author: | |
---|---|
Format: | Article |
Language: | English |
Published: |
KIMS Foundation and Research Center
2020-12-01
|
Series: | Journal of Medical and Scientific Research |
Subjects: | |
Online Access: | http://jmsronline.com/article.aspx?ID=Treatment-modalities-for-coronavirus-disease-2019-COVID-19 |
id |
doaj-9f16e503880d4d83bc4dbc92bbd53cac |
---|---|
record_format |
Article |
spelling |
doaj-9f16e503880d4d83bc4dbc92bbd53cac2021-06-05T11:42:03ZengKIMS Foundation and Research CenterJournal of Medical and Scientific Research2321-13262394-112X2020-12-018S110611110.17727/JMSR.2020/8S1-13Treatment modalities for coronavirus disease 2019 (COVID-19)Panduranga G0Department of Internal Medicine, Krishna Institute of Medical Sciences, Minister Road, Secunderabad-500003, Telangana, India Management of coronavirus disease 2019 (COVID-19) infection is based on limited data and keeps changing rapidly as new clinical data emerge. Remdesivir has shown to reduce duration of hospital stay and has been approved for treatment. In RECOVERY trial, corticosteroids lowered 28-day mortality in patients requiring oxygen supplementation or mechanical ventilation. Convalescent plasma did not live up to its initial promise and is not the standard of care for treatment at present. There’s not enough evidence for use of Hydroxychloroquine, Interleukin-6 inhibitors and many other investigational drugs. Bamlanivimab, casirivimab- imdevimab combo, all monoclonal antibodies, have recently been approved for use in mild to moderate COVIID-19, when there’s a high risk of progression to severe disease. Treatment of COVID-19 depends on stage and severity of disease. Antiviral medications are likely to be most effective when used early. Later in the disease, anti-inflammatory medications, anticoagulants and immunomodulators may be more effective. The world is waiting and hoping for a safe and effective vaccine which can put an end to this worldwide pandemic. http://jmsronline.com/article.aspx?ID=Treatment-modalities-for-coronavirus-disease-2019-COVID-19covid-19treatmentcoronavirus diseaseremdesivirfavipravirhydroxychloroquinecovid antibody therapies |
collection |
DOAJ |
language |
English |
format |
Article |
sources |
DOAJ |
author |
Panduranga G |
spellingShingle |
Panduranga G Treatment modalities for coronavirus disease 2019 (COVID-19) Journal of Medical and Scientific Research covid-19 treatment coronavirus disease remdesivir favipravir hydroxychloroquine covid antibody therapies |
author_facet |
Panduranga G |
author_sort |
Panduranga G |
title |
Treatment modalities for coronavirus disease 2019 (COVID-19) |
title_short |
Treatment modalities for coronavirus disease 2019 (COVID-19) |
title_full |
Treatment modalities for coronavirus disease 2019 (COVID-19) |
title_fullStr |
Treatment modalities for coronavirus disease 2019 (COVID-19) |
title_full_unstemmed |
Treatment modalities for coronavirus disease 2019 (COVID-19) |
title_sort |
treatment modalities for coronavirus disease 2019 (covid-19) |
publisher |
KIMS Foundation and Research Center |
series |
Journal of Medical and Scientific Research |
issn |
2321-1326 2394-112X |
publishDate |
2020-12-01 |
description |
Management of coronavirus disease 2019 (COVID-19) infection is based on limited data and keeps changing rapidly as new clinical data emerge. Remdesivir has shown to reduce duration of hospital stay and has been approved for treatment. In RECOVERY trial, corticosteroids lowered 28-day mortality in patients requiring oxygen supplementation or mechanical ventilation. Convalescent plasma did not live up to its initial promise and is not the standard of care for treatment at present. There’s not enough evidence for use of Hydroxychloroquine, Interleukin-6 inhibitors and many other investigational drugs. Bamlanivimab, casirivimab- imdevimab combo, all monoclonal antibodies, have recently been approved for use in mild to moderate COVIID-19, when there’s a high risk of progression to severe disease. Treatment of COVID-19 depends on stage and severity of disease. Antiviral medications are likely to be most effective when used early. Later in the disease, anti-inflammatory medications, anticoagulants and immunomodulators may be more effective. The world is waiting and hoping for a safe and effective vaccine which can put an end to this worldwide pandemic.
|
topic |
covid-19 treatment coronavirus disease remdesivir favipravir hydroxychloroquine covid antibody therapies |
url |
http://jmsronline.com/article.aspx?ID=Treatment-modalities-for-coronavirus-disease-2019-COVID-19 |
work_keys_str_mv |
AT pandurangag treatmentmodalitiesforcoronavirusdisease2019covid19 |
_version_ |
1721396506617970688 |