Localized populations of CD8 MHC class I tetramer SIV-specific T cells in lymphoid follicles and genital epithelium.

CD8 T cells play an important role in controlling viral infections. We investigated the in situ localization of simian immunodeficiency virus (SIV)-specific T cells in lymph and genital tissues from SIV-infected macaques using MHC-class I tetramers. The majority of tetramer-binding cells localized i...

Full description

Bibliographic Details
Main Authors: Jung Joo Hong, Matthew R Reynolds, Teresa L Mattila, Aaron Hage, David I Watkins, Christopher J Miller, Pamela J Skinner
Format: Article
Language:English
Published: Public Library of Science (PLoS) 2009-01-01
Series:PLoS ONE
Online Access:http://europepmc.org/articles/PMC2607009?pdf=render
id doaj-a450a7089c8e4d8b88e367b2684d4237
record_format Article
spelling doaj-a450a7089c8e4d8b88e367b2684d42372020-11-25T01:42:56ZengPublic Library of Science (PLoS)PLoS ONE1932-62032009-01-0141e413110.1371/journal.pone.0004131Localized populations of CD8 MHC class I tetramer SIV-specific T cells in lymphoid follicles and genital epithelium.Jung Joo HongMatthew R ReynoldsTeresa L MattilaAaron HageDavid I WatkinsChristopher J MillerPamela J SkinnerCD8 T cells play an important role in controlling viral infections. We investigated the in situ localization of simian immunodeficiency virus (SIV)-specific T cells in lymph and genital tissues from SIV-infected macaques using MHC-class I tetramers. The majority of tetramer-binding cells localized in T cell zones and were CD8(+). Curiously, small subpopulations of tetramer-binding cells that had little to no surface CD8 were detected in situ both early and late post-infection, and in both vaginally and rectally inoculated macaques. These tetramer(+)CD8(low/-) cells were more often localized in apparent B cell follicles relative to T cell zones and more often found near or within the genital epithelium than the submucosa. Cells analyzed by flow cytometry showed similar populations of cells. Further immunohistological characterization revealed small populations of tetramer(+)CD20(-) cells inside B cell follicles and that tetramer(+) cells did not stain with gammadelta-TCR nor CD4 antibodies. Negative control tetramer staining indicated that tetramer(+)CD8(low/-) cells were not likely NK cells non-specifically binding to MHC tetramers. These findings have important implications for SIV-specific and other antigen-specific T cell function in these specific tissue locations, and suggest a model in which antigen-specific CD8+ T cells down modulate CD8 upon entering B cell follicles or the epithelial layer of tissues, or alternatively a model in which only antigen-specific CD8 T cells that down-modulate CD8 can enter B cell follicles or the epithelium.http://europepmc.org/articles/PMC2607009?pdf=render
collection DOAJ
language English
format Article
sources DOAJ
author Jung Joo Hong
Matthew R Reynolds
Teresa L Mattila
Aaron Hage
David I Watkins
Christopher J Miller
Pamela J Skinner
spellingShingle Jung Joo Hong
Matthew R Reynolds
Teresa L Mattila
Aaron Hage
David I Watkins
Christopher J Miller
Pamela J Skinner
Localized populations of CD8 MHC class I tetramer SIV-specific T cells in lymphoid follicles and genital epithelium.
PLoS ONE
author_facet Jung Joo Hong
Matthew R Reynolds
Teresa L Mattila
Aaron Hage
David I Watkins
Christopher J Miller
Pamela J Skinner
author_sort Jung Joo Hong
title Localized populations of CD8 MHC class I tetramer SIV-specific T cells in lymphoid follicles and genital epithelium.
title_short Localized populations of CD8 MHC class I tetramer SIV-specific T cells in lymphoid follicles and genital epithelium.
title_full Localized populations of CD8 MHC class I tetramer SIV-specific T cells in lymphoid follicles and genital epithelium.
title_fullStr Localized populations of CD8 MHC class I tetramer SIV-specific T cells in lymphoid follicles and genital epithelium.
title_full_unstemmed Localized populations of CD8 MHC class I tetramer SIV-specific T cells in lymphoid follicles and genital epithelium.
title_sort localized populations of cd8 mhc class i tetramer siv-specific t cells in lymphoid follicles and genital epithelium.
publisher Public Library of Science (PLoS)
series PLoS ONE
issn 1932-6203
publishDate 2009-01-01
description CD8 T cells play an important role in controlling viral infections. We investigated the in situ localization of simian immunodeficiency virus (SIV)-specific T cells in lymph and genital tissues from SIV-infected macaques using MHC-class I tetramers. The majority of tetramer-binding cells localized in T cell zones and were CD8(+). Curiously, small subpopulations of tetramer-binding cells that had little to no surface CD8 were detected in situ both early and late post-infection, and in both vaginally and rectally inoculated macaques. These tetramer(+)CD8(low/-) cells were more often localized in apparent B cell follicles relative to T cell zones and more often found near or within the genital epithelium than the submucosa. Cells analyzed by flow cytometry showed similar populations of cells. Further immunohistological characterization revealed small populations of tetramer(+)CD20(-) cells inside B cell follicles and that tetramer(+) cells did not stain with gammadelta-TCR nor CD4 antibodies. Negative control tetramer staining indicated that tetramer(+)CD8(low/-) cells were not likely NK cells non-specifically binding to MHC tetramers. These findings have important implications for SIV-specific and other antigen-specific T cell function in these specific tissue locations, and suggest a model in which antigen-specific CD8+ T cells down modulate CD8 upon entering B cell follicles or the epithelial layer of tissues, or alternatively a model in which only antigen-specific CD8 T cells that down-modulate CD8 can enter B cell follicles or the epithelium.
url http://europepmc.org/articles/PMC2607009?pdf=render
work_keys_str_mv AT jungjoohong localizedpopulationsofcd8mhcclassitetramersivspecifictcellsinlymphoidfolliclesandgenitalepithelium
AT matthewrreynolds localizedpopulationsofcd8mhcclassitetramersivspecifictcellsinlymphoidfolliclesandgenitalepithelium
AT teresalmattila localizedpopulationsofcd8mhcclassitetramersivspecifictcellsinlymphoidfolliclesandgenitalepithelium
AT aaronhage localizedpopulationsofcd8mhcclassitetramersivspecifictcellsinlymphoidfolliclesandgenitalepithelium
AT davidiwatkins localizedpopulationsofcd8mhcclassitetramersivspecifictcellsinlymphoidfolliclesandgenitalepithelium
AT christopherjmiller localizedpopulationsofcd8mhcclassitetramersivspecifictcellsinlymphoidfolliclesandgenitalepithelium
AT pamelajskinner localizedpopulationsofcd8mhcclassitetramersivspecifictcellsinlymphoidfolliclesandgenitalepithelium
_version_ 1725034138206994432