Growth, Dietary Intake, and Vitamin D Receptor (VDR) Promoter Genotype in Indonesian School-Age Children

Nutrition has been known as a predominant factor associated with stunting. However, some studies have discovered a genetic contribution in calcium absorption that will affect growth, known as the VDR gene. The aim of this study was to assess the association between VDR gene polymorphism and dietary...

Full description

Bibliographic Details
Main Authors: Tiffany Cornelia Angelin, Saptawati Bardosono, Dewi Shinta, Umi Fahmida
Format: Article
Language:English
Published: MDPI AG 2021-08-01
Series:Nutrients
Subjects:
Online Access:https://www.mdpi.com/2072-6643/13/9/2904
id doaj-d3851d6d980547339ae2f3b2a04be4dd
record_format Article
spelling doaj-d3851d6d980547339ae2f3b2a04be4dd2021-09-26T00:50:38ZengMDPI AGNutrients2072-66432021-08-01132904290410.3390/nu13092904Growth, Dietary Intake, and Vitamin D Receptor (VDR) Promoter Genotype in Indonesian School-Age ChildrenTiffany Cornelia Angelin0Saptawati Bardosono1Dewi Shinta2Umi Fahmida3Southeast Asian Ministers of Education Organization Regional Center for Food and Nutrition (SEAMEO RECFON)-Pusat Kajian Gizi Regional, Universitas Indonesia, Jakarta 10430, IndonesiaDepartment of Nutrition, Faculty of Medicine, Universitas Indonesia—Dr. Cipto Mangunkusumo General Hospital, Jakarta 10430, IndonesiaSoutheast Asian Ministers of Education Organization Regional Center for Food and Nutrition (SEAMEO RECFON)-Pusat Kajian Gizi Regional, Universitas Indonesia, Jakarta 10430, IndonesiaSoutheast Asian Ministers of Education Organization Regional Center for Food and Nutrition (SEAMEO RECFON)-Pusat Kajian Gizi Regional, Universitas Indonesia, Jakarta 10430, IndonesiaNutrition has been known as a predominant factor associated with stunting. However, some studies have discovered a genetic contribution in calcium absorption that will affect growth, known as the VDR gene. The aim of this study was to assess the association between VDR gene polymorphism and dietary intake towards height-for-age z-score (HAZ) of elementary school children in Malang District, East Java. This study analyzed the baseline of a randomized trial in East Java, Indonesia. School children aged 8–10 years old (<i>n</i> = 142) were included in this study. Energy, protein, calcium, and vitamin D intakes were obtained using 4-day 24-h dietary recalls. Two SNPs located in the promoter region of VDR gene were selected (rs11568820 and rs4516035) and analyzed using Real-Time PCR. The result showed a significant correlation between energy and protein intake with HAZ of the children (<i>p</i> = 0.030 and <i>p</i> = 0.016, respectively). The association between VDR gene and HAZ was not found (<i>p</i> > 0.05). Adjusted by other factors, protein intake was significantly correlated with HAZ (β = 0.034, 95% CI 0.015–0.052, <i>p</i> < 0.001, adj. R<sup>2</sup> = 0.089). The children in our study had a favorable VDR gene genotype, however the effect of VDR gene promoter activity might not be revealed due to very low vitamin D and calcium intake to stimulate intestinal calcium absorption which in turn affects HAZ.https://www.mdpi.com/2072-6643/13/9/2904stuntingchildrenheight-for-age z-score (HAZ)dietary intakeVDR geneIndonesia
collection DOAJ
language English
format Article
sources DOAJ
author Tiffany Cornelia Angelin
Saptawati Bardosono
Dewi Shinta
Umi Fahmida
spellingShingle Tiffany Cornelia Angelin
Saptawati Bardosono
Dewi Shinta
Umi Fahmida
Growth, Dietary Intake, and Vitamin D Receptor (VDR) Promoter Genotype in Indonesian School-Age Children
Nutrients
stunting
children
height-for-age z-score (HAZ)
dietary intake
VDR gene
Indonesia
author_facet Tiffany Cornelia Angelin
Saptawati Bardosono
Dewi Shinta
Umi Fahmida
author_sort Tiffany Cornelia Angelin
title Growth, Dietary Intake, and Vitamin D Receptor (VDR) Promoter Genotype in Indonesian School-Age Children
title_short Growth, Dietary Intake, and Vitamin D Receptor (VDR) Promoter Genotype in Indonesian School-Age Children
title_full Growth, Dietary Intake, and Vitamin D Receptor (VDR) Promoter Genotype in Indonesian School-Age Children
title_fullStr Growth, Dietary Intake, and Vitamin D Receptor (VDR) Promoter Genotype in Indonesian School-Age Children
title_full_unstemmed Growth, Dietary Intake, and Vitamin D Receptor (VDR) Promoter Genotype in Indonesian School-Age Children
title_sort growth, dietary intake, and vitamin d receptor (vdr) promoter genotype in indonesian school-age children
publisher MDPI AG
series Nutrients
issn 2072-6643
publishDate 2021-08-01
description Nutrition has been known as a predominant factor associated with stunting. However, some studies have discovered a genetic contribution in calcium absorption that will affect growth, known as the VDR gene. The aim of this study was to assess the association between VDR gene polymorphism and dietary intake towards height-for-age z-score (HAZ) of elementary school children in Malang District, East Java. This study analyzed the baseline of a randomized trial in East Java, Indonesia. School children aged 8–10 years old (<i>n</i> = 142) were included in this study. Energy, protein, calcium, and vitamin D intakes were obtained using 4-day 24-h dietary recalls. Two SNPs located in the promoter region of VDR gene were selected (rs11568820 and rs4516035) and analyzed using Real-Time PCR. The result showed a significant correlation between energy and protein intake with HAZ of the children (<i>p</i> = 0.030 and <i>p</i> = 0.016, respectively). The association between VDR gene and HAZ was not found (<i>p</i> > 0.05). Adjusted by other factors, protein intake was significantly correlated with HAZ (β = 0.034, 95% CI 0.015–0.052, <i>p</i> < 0.001, adj. R<sup>2</sup> = 0.089). The children in our study had a favorable VDR gene genotype, however the effect of VDR gene promoter activity might not be revealed due to very low vitamin D and calcium intake to stimulate intestinal calcium absorption which in turn affects HAZ.
topic stunting
children
height-for-age z-score (HAZ)
dietary intake
VDR gene
Indonesia
url https://www.mdpi.com/2072-6643/13/9/2904
work_keys_str_mv AT tiffanycorneliaangelin growthdietaryintakeandvitamindreceptorvdrpromotergenotypeinindonesianschoolagechildren
AT saptawatibardosono growthdietaryintakeandvitamindreceptorvdrpromotergenotypeinindonesianschoolagechildren
AT dewishinta growthdietaryintakeandvitamindreceptorvdrpromotergenotypeinindonesianschoolagechildren
AT umifahmida growthdietaryintakeandvitamindreceptorvdrpromotergenotypeinindonesianschoolagechildren
_version_ 1716869740252626944