A Comparative Study of Majnun Image Story Among Wild Beasts of Shah Tahmasp's Khamseh (Five Persian books) with Textile Image Recorded in Boston Museum, Registration number: 1928.2, based on Intertextuality Theory
Story of Layla and Majnun is one of most famous literary works which has attracted all artists and made enrich their works. due to a solidarity of literature with painting, painters among these artists, revived a process of making illustrated works, which were surely transfer of poets thinking. In t...
Main Authors: | , |
---|---|
Format: | Article |
Language: | fas |
Published: |
The Institute of Islamic Art Studies
2019-06-01
|
Series: | هنر اسلامی |
Subjects: | |
Online Access: | http://www.sysislamicartjournal.ir/article_93926_67fedbf2abd0af6b4350ebbd400b27c3.pdf |
id |
doaj-d4c9958d8cdb4a479ef478a12d06b6ae |
---|---|
record_format |
Article |
spelling |
doaj-d4c9958d8cdb4a479ef478a12d06b6ae2021-04-24T10:40:50ZfasThe Institute of Islamic Art Studiesهنر اسلامی1735-708X2676-77592019-06-011534294610.22034/ias.2019.9392693926A Comparative Study of Majnun Image Story Among Wild Beasts of Shah Tahmasp's Khamseh (Five Persian books) with Textile Image Recorded in Boston Museum, Registration number: 1928.2, based on Intertextuality TheoryَMohammadreza Sharifzadeh0Zahra Taghados Nejhad1دانشیار دانشکده هنر، دانشگاه آزاد اسلامی، واحد تهران مرکزکارشناس پژوهشکده هنرهای سنتی پژوهشگاه میراث فرهنگی و گردشگریStory of Layla and Majnun is one of most famous literary works which has attracted all artists and made enrich their works. due to a solidarity of literature with painting, painters among these artists, revived a process of making illustrated works, which were surely transfer of poets thinking. In this regard, the literature of Shahnameh and Khamseh has a special position. Considering influence of the Safavid painters in royal workshops and effect of painting on other arts fields, including weaving, it is possible to find effects of literature on motifs of these woven fabrics. A main purpose of this paper is to identify and study common points of literature with images and motifs of this story on textiles in Safavid era and to identify a relationship between painters and textile designers. findings of this paper show that themes of lyric poetry are reflected in motifs of textiles and images. Because these stories have been cultural commonalities, and painters in this period have been fabric designers too, considering a comparison of Nizami poem in painting and textile-weaving.http://www.sysislamicartjournal.ir/article_93926_67fedbf2abd0af6b4350ebbd400b27c3.pdfliteraturelayla and majnunimagetextiles motifintertextuality |
collection |
DOAJ |
language |
fas |
format |
Article |
sources |
DOAJ |
author |
َMohammadreza Sharifzadeh Zahra Taghados Nejhad |
spellingShingle |
َMohammadreza Sharifzadeh Zahra Taghados Nejhad A Comparative Study of Majnun Image Story Among Wild Beasts of Shah Tahmasp's Khamseh (Five Persian books) with Textile Image Recorded in Boston Museum, Registration number: 1928.2, based on Intertextuality Theory هنر اسلامی literature layla and majnun image textiles motif intertextuality |
author_facet |
َMohammadreza Sharifzadeh Zahra Taghados Nejhad |
author_sort |
َMohammadreza Sharifzadeh |
title |
A Comparative Study of Majnun Image Story Among Wild Beasts of Shah Tahmasp's Khamseh (Five Persian books) with Textile Image Recorded in Boston Museum, Registration number: 1928.2, based on Intertextuality Theory |
title_short |
A Comparative Study of Majnun Image Story Among Wild Beasts of Shah Tahmasp's Khamseh (Five Persian books) with Textile Image Recorded in Boston Museum, Registration number: 1928.2, based on Intertextuality Theory |
title_full |
A Comparative Study of Majnun Image Story Among Wild Beasts of Shah Tahmasp's Khamseh (Five Persian books) with Textile Image Recorded in Boston Museum, Registration number: 1928.2, based on Intertextuality Theory |
title_fullStr |
A Comparative Study of Majnun Image Story Among Wild Beasts of Shah Tahmasp's Khamseh (Five Persian books) with Textile Image Recorded in Boston Museum, Registration number: 1928.2, based on Intertextuality Theory |
title_full_unstemmed |
A Comparative Study of Majnun Image Story Among Wild Beasts of Shah Tahmasp's Khamseh (Five Persian books) with Textile Image Recorded in Boston Museum, Registration number: 1928.2, based on Intertextuality Theory |
title_sort |
comparative study of majnun image story among wild beasts of shah tahmasp's khamseh (five persian books) with textile image recorded in boston museum, registration number: 1928.2, based on intertextuality theory |
publisher |
The Institute of Islamic Art Studies |
series |
هنر اسلامی |
issn |
1735-708X 2676-7759 |
publishDate |
2019-06-01 |
description |
Story of Layla and Majnun is one of most famous literary works which has attracted all artists and made enrich their works. due to a solidarity of literature with painting, painters among these artists, revived a process of making illustrated works, which were surely transfer of poets thinking. In this regard, the literature of Shahnameh and Khamseh has a special position. Considering influence of the Safavid painters in royal workshops and effect of painting on other arts fields, including weaving, it is possible to find effects of literature on motifs of these woven fabrics. A main purpose of this paper is to identify and study common points of literature with images and motifs of this story on textiles in Safavid era and to identify a relationship between painters and textile designers. findings of this paper show that themes of lyric poetry are reflected in motifs of textiles and images. Because these stories have been cultural commonalities, and painters in this period have been fabric designers too, considering a comparison of Nizami poem in painting and textile-weaving. |
topic |
literature layla and majnun image textiles motif intertextuality |
url |
http://www.sysislamicartjournal.ir/article_93926_67fedbf2abd0af6b4350ebbd400b27c3.pdf |
work_keys_str_mv |
AT mohammadrezasharifzadeh acomparativestudyofmajnunimagestoryamongwildbeastsofshahtahmaspskhamsehfivepersianbookswithtextileimagerecordedinbostonmuseumregistrationnumber19282basedonintertextualitytheory AT zahrataghadosnejhad acomparativestudyofmajnunimagestoryamongwildbeastsofshahtahmaspskhamsehfivepersianbookswithtextileimagerecordedinbostonmuseumregistrationnumber19282basedonintertextualitytheory AT mohammadrezasharifzadeh comparativestudyofmajnunimagestoryamongwildbeastsofshahtahmaspskhamsehfivepersianbookswithtextileimagerecordedinbostonmuseumregistrationnumber19282basedonintertextualitytheory AT zahrataghadosnejhad comparativestudyofmajnunimagestoryamongwildbeastsofshahtahmaspskhamsehfivepersianbookswithtextileimagerecordedinbostonmuseumregistrationnumber19282basedonintertextualitytheory |
_version_ |
1721511154866454528 |