Maximum Power Transfer versus Efficiency in Mid-Range Wireless Power Transfer Systems
AbstractThe condition for maximum power transfer of 2-coils wireless power transfer (WPT) system is derived from circuit analysis and discussed together with the respective WPT system efficiency (η). In the sequence, it is shown that a 4-coils WPT system (which can be divided in source, two communic...
Main Authors: | , , |
---|---|
Format: | Article |
Language: | English |
Published: |
Sociedade Brasileira de Microondas e Optoeletrônica; Sociedade Brasileira de Eletromagnetismo
|
Series: | Journal of Microwaves, Optoelectronics and Electromagnetic Applications |
Subjects: | |
Online Access: | http://www.scielo.br/scielo.php?script=sci_arttext&pid=S2179-10742015000100097&lng=en&tlng=en |
id |
doaj-d6b2096169144fb49b03c56b5ac7e317 |
---|---|
record_format |
Article |
spelling |
doaj-d6b2096169144fb49b03c56b5ac7e3172020-11-25T00:48:32ZengSociedade Brasileira de Microondas e Optoeletrônica; Sociedade Brasileira de EletromagnetismoJournal of Microwaves, Optoelectronics and Electromagnetic Applications2179-10741419710910.1590/2179-10742015v14i1433S2179-10742015000100097Maximum Power Transfer versus Efficiency in Mid-Range Wireless Power Transfer SystemsPaulo J. AbattiSérgio F. PichorimCaio M. de MirandaAbstractThe condition for maximum power transfer of 2-coils wireless power transfer (WPT) system is derived from circuit analysis and discussed together with the respective WPT system efficiency (η). In the sequence, it is shown that a 4-coils WPT system (which can be divided in source, two communication and load circuits) without power losses at the two communication circuits (ideal 4-coils WPT system) presents, from maximum power transfer and efficiency point of view, a performance similar to those of a 2-coils WPT system. The exception is the influence of coupling coefficient (k): in 2-coils system η increases as k approaches one, while in ideal 4-coils WPT system η increases as k between the two communication coils approaches zero. In addition, realistic 4-coils WPT systems (with power losses at the two communication circuits) are also analyzed showing, for instance, that η presents a maximum as a function of k of the communication coils. In order to validate the presented theory, 4 coils were built, and a setup to perform 2-coils and 4-coils WPT systems has been carried out. Practical results show good agreement with the developed theory.http://www.scielo.br/scielo.php?script=sci_arttext&pid=S2179-10742015000100097&lng=en&tlng=enMaximum power transferpower transfer efficiencyrelative power transferwireless power transfer |
collection |
DOAJ |
language |
English |
format |
Article |
sources |
DOAJ |
author |
Paulo J. Abatti Sérgio F. Pichorim Caio M. de Miranda |
spellingShingle |
Paulo J. Abatti Sérgio F. Pichorim Caio M. de Miranda Maximum Power Transfer versus Efficiency in Mid-Range Wireless Power Transfer Systems Journal of Microwaves, Optoelectronics and Electromagnetic Applications Maximum power transfer power transfer efficiency relative power transfer wireless power transfer |
author_facet |
Paulo J. Abatti Sérgio F. Pichorim Caio M. de Miranda |
author_sort |
Paulo J. Abatti |
title |
Maximum Power Transfer versus Efficiency in Mid-Range Wireless Power Transfer Systems |
title_short |
Maximum Power Transfer versus Efficiency in Mid-Range Wireless Power Transfer Systems |
title_full |
Maximum Power Transfer versus Efficiency in Mid-Range Wireless Power Transfer Systems |
title_fullStr |
Maximum Power Transfer versus Efficiency in Mid-Range Wireless Power Transfer Systems |
title_full_unstemmed |
Maximum Power Transfer versus Efficiency in Mid-Range Wireless Power Transfer Systems |
title_sort |
maximum power transfer versus efficiency in mid-range wireless power transfer systems |
publisher |
Sociedade Brasileira de Microondas e Optoeletrônica; Sociedade Brasileira de Eletromagnetismo |
series |
Journal of Microwaves, Optoelectronics and Electromagnetic Applications |
issn |
2179-1074 |
description |
AbstractThe condition for maximum power transfer of 2-coils wireless power transfer (WPT) system is derived from circuit analysis and discussed together with the respective WPT system efficiency (η). In the sequence, it is shown that a 4-coils WPT system (which can be divided in source, two communication and load circuits) without power losses at the two communication circuits (ideal 4-coils WPT system) presents, from maximum power transfer and efficiency point of view, a performance similar to those of a 2-coils WPT system. The exception is the influence of coupling coefficient (k): in 2-coils system η increases as k approaches one, while in ideal 4-coils WPT system η increases as k between the two communication coils approaches zero. In addition, realistic 4-coils WPT systems (with power losses at the two communication circuits) are also analyzed showing, for instance, that η presents a maximum as a function of k of the communication coils. In order to validate the presented theory, 4 coils were built, and a setup to perform 2-coils and 4-coils WPT systems has been carried out. Practical results show good agreement with the developed theory. |
topic |
Maximum power transfer power transfer efficiency relative power transfer wireless power transfer |
url |
http://www.scielo.br/scielo.php?script=sci_arttext&pid=S2179-10742015000100097&lng=en&tlng=en |
work_keys_str_mv |
AT paulojabatti maximumpowertransferversusefficiencyinmidrangewirelesspowertransfersystems AT sergiofpichorim maximumpowertransferversusefficiencyinmidrangewirelesspowertransfersystems AT caiomdemiranda maximumpowertransferversusefficiencyinmidrangewirelesspowertransfersystems |
_version_ |
1725255702336765952 |