Role of Klotho in Hyperglycemia: Its Levels and Effects on Fibroblast Growth Factor Receptors, Glycolysis, and Glomerular Filtration

Hyperglycemic conditions (HG), at early stages of diabetic nephropathy (DN), cause a decrease in podocyte numbers and an aberration of their function as key cells for glomerular plasma filtration. Klotho protein was shown to overcome some negative effects of hyperglycemia. Klotho is also a corecepto...

Full description

Bibliographic Details
Main Authors: Marlena Typiak, Tomasz Kulesza, Patrycja Rachubik, Dorota Rogacka, Irena Audzeyenka, Stefan Angielski, Moin A. Saleem, Agnieszka Piwkowska
Format: Article
Language:English
Published: MDPI AG 2021-07-01
Series:International Journal of Molecular Sciences
Subjects:
Online Access:https://www.mdpi.com/1422-0067/22/15/7867
id doaj-dbcf4d70036b4d93911ff9d34cb48a8c
record_format Article
spelling doaj-dbcf4d70036b4d93911ff9d34cb48a8c2021-08-06T15:24:35ZengMDPI AGInternational Journal of Molecular Sciences1661-65961422-00672021-07-01227867786710.3390/ijms22157867Role of Klotho in Hyperglycemia: Its Levels and Effects on Fibroblast Growth Factor Receptors, Glycolysis, and Glomerular FiltrationMarlena Typiak0Tomasz Kulesza1Patrycja Rachubik2Dorota Rogacka3Irena Audzeyenka4Stefan Angielski5Moin A. Saleem6Agnieszka Piwkowska7Laboratory of Molecular and Cellular Nephrology, Mossakowski Medical Research Institute, Polish Academy of Sciences, Wita Stwosza 63, 80-308 Gdansk, PolandLaboratory of Molecular and Cellular Nephrology, Mossakowski Medical Research Institute, Polish Academy of Sciences, Wita Stwosza 63, 80-308 Gdansk, PolandLaboratory of Molecular and Cellular Nephrology, Mossakowski Medical Research Institute, Polish Academy of Sciences, Wita Stwosza 63, 80-308 Gdansk, PolandLaboratory of Molecular and Cellular Nephrology, Mossakowski Medical Research Institute, Polish Academy of Sciences, Wita Stwosza 63, 80-308 Gdansk, PolandLaboratory of Molecular and Cellular Nephrology, Mossakowski Medical Research Institute, Polish Academy of Sciences, Wita Stwosza 63, 80-308 Gdansk, PolandLaboratory of Molecular and Cellular Nephrology, Mossakowski Medical Research Institute, Polish Academy of Sciences, Wita Stwosza 63, 80-308 Gdansk, PolandBristol Renal, Dorothy Hodgkin Building, University of Bristol, Bristol BS1 3NY, UKLaboratory of Molecular and Cellular Nephrology, Mossakowski Medical Research Institute, Polish Academy of Sciences, Wita Stwosza 63, 80-308 Gdansk, PolandHyperglycemic conditions (HG), at early stages of diabetic nephropathy (DN), cause a decrease in podocyte numbers and an aberration of their function as key cells for glomerular plasma filtration. Klotho protein was shown to overcome some negative effects of hyperglycemia. Klotho is also a coreceptor for fibroblast growth factor receptors (FGFRs), the signaling of which, together with a proper rate of glycolysis in podocytes, is needed for a proper function of the glomerular filtration barrier. Therefore, we measured levels of Klotho in renal tissue, serum, and urine shortly after DN induction. We investigated whether it influences levels of FGFRs, rates of glycolysis in podocytes, and albumin permeability. During hyperglycemia, the level of membrane-bound Klotho in renal tissue decreased, with an increase in the shedding of soluble Klotho, its higher presence in serum, and lower urinary excretion. The addition of Klotho increased FGFR levels, especially FGFR1/FGFR2, after their HG-induced decrease. Klotho also increased levels of glycolytic parameters of podocytes, and decreased podocytic and glomerular albumin permeability in HG. Thus, we found that the decrease in the urinary excretion of Klotho might be an early biomarker of DN and that Klotho administration may have several beneficial effects on renal function in DN.https://www.mdpi.com/1422-0067/22/15/7867Klotho proteindiabetes mellitusdiabetic nephropathyhyperglycemiafibroblast growth factor receptors
collection DOAJ
language English
format Article
sources DOAJ
author Marlena Typiak
Tomasz Kulesza
Patrycja Rachubik
Dorota Rogacka
Irena Audzeyenka
Stefan Angielski
Moin A. Saleem
Agnieszka Piwkowska
spellingShingle Marlena Typiak
Tomasz Kulesza
Patrycja Rachubik
Dorota Rogacka
Irena Audzeyenka
Stefan Angielski
Moin A. Saleem
Agnieszka Piwkowska
Role of Klotho in Hyperglycemia: Its Levels and Effects on Fibroblast Growth Factor Receptors, Glycolysis, and Glomerular Filtration
International Journal of Molecular Sciences
Klotho protein
diabetes mellitus
diabetic nephropathy
hyperglycemia
fibroblast growth factor receptors
author_facet Marlena Typiak
Tomasz Kulesza
Patrycja Rachubik
Dorota Rogacka
Irena Audzeyenka
Stefan Angielski
Moin A. Saleem
Agnieszka Piwkowska
author_sort Marlena Typiak
title Role of Klotho in Hyperglycemia: Its Levels and Effects on Fibroblast Growth Factor Receptors, Glycolysis, and Glomerular Filtration
title_short Role of Klotho in Hyperglycemia: Its Levels and Effects on Fibroblast Growth Factor Receptors, Glycolysis, and Glomerular Filtration
title_full Role of Klotho in Hyperglycemia: Its Levels and Effects on Fibroblast Growth Factor Receptors, Glycolysis, and Glomerular Filtration
title_fullStr Role of Klotho in Hyperglycemia: Its Levels and Effects on Fibroblast Growth Factor Receptors, Glycolysis, and Glomerular Filtration
title_full_unstemmed Role of Klotho in Hyperglycemia: Its Levels and Effects on Fibroblast Growth Factor Receptors, Glycolysis, and Glomerular Filtration
title_sort role of klotho in hyperglycemia: its levels and effects on fibroblast growth factor receptors, glycolysis, and glomerular filtration
publisher MDPI AG
series International Journal of Molecular Sciences
issn 1661-6596
1422-0067
publishDate 2021-07-01
description Hyperglycemic conditions (HG), at early stages of diabetic nephropathy (DN), cause a decrease in podocyte numbers and an aberration of their function as key cells for glomerular plasma filtration. Klotho protein was shown to overcome some negative effects of hyperglycemia. Klotho is also a coreceptor for fibroblast growth factor receptors (FGFRs), the signaling of which, together with a proper rate of glycolysis in podocytes, is needed for a proper function of the glomerular filtration barrier. Therefore, we measured levels of Klotho in renal tissue, serum, and urine shortly after DN induction. We investigated whether it influences levels of FGFRs, rates of glycolysis in podocytes, and albumin permeability. During hyperglycemia, the level of membrane-bound Klotho in renal tissue decreased, with an increase in the shedding of soluble Klotho, its higher presence in serum, and lower urinary excretion. The addition of Klotho increased FGFR levels, especially FGFR1/FGFR2, after their HG-induced decrease. Klotho also increased levels of glycolytic parameters of podocytes, and decreased podocytic and glomerular albumin permeability in HG. Thus, we found that the decrease in the urinary excretion of Klotho might be an early biomarker of DN and that Klotho administration may have several beneficial effects on renal function in DN.
topic Klotho protein
diabetes mellitus
diabetic nephropathy
hyperglycemia
fibroblast growth factor receptors
url https://www.mdpi.com/1422-0067/22/15/7867
work_keys_str_mv AT marlenatypiak roleofklothoinhyperglycemiaitslevelsandeffectsonfibroblastgrowthfactorreceptorsglycolysisandglomerularfiltration
AT tomaszkulesza roleofklothoinhyperglycemiaitslevelsandeffectsonfibroblastgrowthfactorreceptorsglycolysisandglomerularfiltration
AT patrycjarachubik roleofklothoinhyperglycemiaitslevelsandeffectsonfibroblastgrowthfactorreceptorsglycolysisandglomerularfiltration
AT dorotarogacka roleofklothoinhyperglycemiaitslevelsandeffectsonfibroblastgrowthfactorreceptorsglycolysisandglomerularfiltration
AT irenaaudzeyenka roleofklothoinhyperglycemiaitslevelsandeffectsonfibroblastgrowthfactorreceptorsglycolysisandglomerularfiltration
AT stefanangielski roleofklothoinhyperglycemiaitslevelsandeffectsonfibroblastgrowthfactorreceptorsglycolysisandglomerularfiltration
AT moinasaleem roleofklothoinhyperglycemiaitslevelsandeffectsonfibroblastgrowthfactorreceptorsglycolysisandglomerularfiltration
AT agnieszkapiwkowska roleofklothoinhyperglycemiaitslevelsandeffectsonfibroblastgrowthfactorreceptorsglycolysisandglomerularfiltration
_version_ 1721218433569259520