QTL Mapping for Adult Plant Resistance to Powdery Mildew in Italian Wheat cv. Strampelli

The Italian wheat cv. Strampelli displays high resistance to powdery mildew caused by Blumeria graminis f. sp. tritici. The objective of this study was to map quantitative trait loci (QTLs) for resistance to powdery mildew in a population of 249 F2:3 lines from Strampelli/Huixianhong. Adult plant po...

Full description

Bibliographic Details
Main Authors: Muhammad Azeem Asad, Bin BAI, Cai-xia LAN, Jun YAN, Xian-chun XIA, Yong ZHANG, Zhong-hu HE
Format: Article
Language:English
Published: Elsevier 2013-05-01
Series:Journal of Integrative Agriculture
Subjects:
Online Access:http://www.sciencedirect.com/science/article/pii/S209531191360297X
id doaj-e0760bc0ac1d4b068826ac994fdb5e36
record_format Article
spelling doaj-e0760bc0ac1d4b068826ac994fdb5e362021-06-07T06:48:33ZengElsevierJournal of Integrative Agriculture2095-31192013-05-01125756764QTL Mapping for Adult Plant Resistance to Powdery Mildew in Italian Wheat cv. StrampelliMuhammad Azeem Asad0Bin BAI1Cai-xia LAN2Jun YAN3Xian-chun XIA4Yong ZHANG5Zhong-hu HE6National Wheat Improvement Center/National Key Facility for Crop Gene Resources and Genetic Improvement/Institute of Crop Sciences, Chinese Academy of Agricultural Sciences (CAAS), Beijing 100081, P.R. ChinaNational Wheat Improvement Center/National Key Facility for Crop Gene Resources and Genetic Improvement/Institute of Crop Sciences, Chinese Academy of Agricultural Sciences (CAAS), Beijing 100081, P.R. ChinaNational Wheat Improvement Center/National Key Facility for Crop Gene Resources and Genetic Improvement/Institute of Crop Sciences, Chinese Academy of Agricultural Sciences (CAAS), Beijing 100081, P.R. ChinaCotton Research Institute, Chinese Academy of Agricultural Sciences (CAAS), Anyang 455000, P.R. ChinaNational Wheat Improvement Center/National Key Facility for Crop Gene Resources and Genetic Improvement/Institute of Crop Sciences, Chinese Academy of Agricultural Sciences (CAAS), Beijing 100081, P.R. ChinaNational Wheat Improvement Center/National Key Facility for Crop Gene Resources and Genetic Improvement/Institute of Crop Sciences, Chinese Academy of Agricultural Sciences (CAAS), Beijing 100081, P.R. ChinaNational Wheat Improvement Center/National Key Facility for Crop Gene Resources and Genetic Improvement/Institute of Crop Sciences, Chinese Academy of Agricultural Sciences (CAAS), Beijing 100081, P.R. China; International Maize and Wheat Improvement Center (CIMMYT) China Office, Beijing 100081, P.R. China; Correspondence HE Zhong-hu, Tel: +86-10-82108547The Italian wheat cv. Strampelli displays high resistance to powdery mildew caused by Blumeria graminis f. sp. tritici. The objective of this study was to map quantitative trait loci (QTLs) for resistance to powdery mildew in a population of 249 F2:3 lines from Strampelli/Huixianhong. Adult plant powdery mildew tests were conducted over 2 yr in Beijing and 1 yr in Anyang and simple sequence repeat (SSR) markers were used for genotyping. QTLs Qpm.caas-3BS, Qpm.caas-5BL.1, and Qpm.caas-7DS were consistent across environments whereas, Qpm.caas-2BS.1 found in two environments, explained 0.4–1.6, 5.5–6.9, 27.1–34.5, and 1.0–3.5% of the phenotypic variation respectively. Qpm.caas-7DS corresponded to the genomic location of Pm38/Lr34/Yr18. Qpm.caas-4BL was identified in Anyang 2010 and Beijing 2011, accounting for 1.9–3.5% of phenotypic variation. Qpm.caas-2BS.1 and Qpm.caas-5BL.1 contributed by Strampelli and Qpm.caas-3BS by Huixianhong, seem to be new QTL for powdery mildew resistance. Qpm.caas-4BL, Qpm.caas-5BL.3, and Qpm.caas-7DS contributed by Strampelli appeared to be in the same genomic regions as those mapped previously for stripe rust resistance in the same population, indicating that these loci conferred resistance to both stripe rust and powdery mildew. Strampelli could be a valuable genetic resource for improving durable resistance to both powdery mildew and stripe rust in wheat.http://www.sciencedirect.com/science/article/pii/S209531191360297XQTL analysisSSR markersBlumeria graminisdurable resistanceTriticum aestivum L
collection DOAJ
language English
format Article
sources DOAJ
author Muhammad Azeem Asad
Bin BAI
Cai-xia LAN
Jun YAN
Xian-chun XIA
Yong ZHANG
Zhong-hu HE
spellingShingle Muhammad Azeem Asad
Bin BAI
Cai-xia LAN
Jun YAN
Xian-chun XIA
Yong ZHANG
Zhong-hu HE
QTL Mapping for Adult Plant Resistance to Powdery Mildew in Italian Wheat cv. Strampelli
Journal of Integrative Agriculture
QTL analysis
SSR markers
Blumeria graminis
durable resistance
Triticum aestivum L
author_facet Muhammad Azeem Asad
Bin BAI
Cai-xia LAN
Jun YAN
Xian-chun XIA
Yong ZHANG
Zhong-hu HE
author_sort Muhammad Azeem Asad
title QTL Mapping for Adult Plant Resistance to Powdery Mildew in Italian Wheat cv. Strampelli
title_short QTL Mapping for Adult Plant Resistance to Powdery Mildew in Italian Wheat cv. Strampelli
title_full QTL Mapping for Adult Plant Resistance to Powdery Mildew in Italian Wheat cv. Strampelli
title_fullStr QTL Mapping for Adult Plant Resistance to Powdery Mildew in Italian Wheat cv. Strampelli
title_full_unstemmed QTL Mapping for Adult Plant Resistance to Powdery Mildew in Italian Wheat cv. Strampelli
title_sort qtl mapping for adult plant resistance to powdery mildew in italian wheat cv. strampelli
publisher Elsevier
series Journal of Integrative Agriculture
issn 2095-3119
publishDate 2013-05-01
description The Italian wheat cv. Strampelli displays high resistance to powdery mildew caused by Blumeria graminis f. sp. tritici. The objective of this study was to map quantitative trait loci (QTLs) for resistance to powdery mildew in a population of 249 F2:3 lines from Strampelli/Huixianhong. Adult plant powdery mildew tests were conducted over 2 yr in Beijing and 1 yr in Anyang and simple sequence repeat (SSR) markers were used for genotyping. QTLs Qpm.caas-3BS, Qpm.caas-5BL.1, and Qpm.caas-7DS were consistent across environments whereas, Qpm.caas-2BS.1 found in two environments, explained 0.4–1.6, 5.5–6.9, 27.1–34.5, and 1.0–3.5% of the phenotypic variation respectively. Qpm.caas-7DS corresponded to the genomic location of Pm38/Lr34/Yr18. Qpm.caas-4BL was identified in Anyang 2010 and Beijing 2011, accounting for 1.9–3.5% of phenotypic variation. Qpm.caas-2BS.1 and Qpm.caas-5BL.1 contributed by Strampelli and Qpm.caas-3BS by Huixianhong, seem to be new QTL for powdery mildew resistance. Qpm.caas-4BL, Qpm.caas-5BL.3, and Qpm.caas-7DS contributed by Strampelli appeared to be in the same genomic regions as those mapped previously for stripe rust resistance in the same population, indicating that these loci conferred resistance to both stripe rust and powdery mildew. Strampelli could be a valuable genetic resource for improving durable resistance to both powdery mildew and stripe rust in wheat.
topic QTL analysis
SSR markers
Blumeria graminis
durable resistance
Triticum aestivum L
url http://www.sciencedirect.com/science/article/pii/S209531191360297X
work_keys_str_mv AT muhammadazeemasad qtlmappingforadultplantresistancetopowderymildewinitalianwheatcvstrampelli
AT binbai qtlmappingforadultplantresistancetopowderymildewinitalianwheatcvstrampelli
AT caixialan qtlmappingforadultplantresistancetopowderymildewinitalianwheatcvstrampelli
AT junyan qtlmappingforadultplantresistancetopowderymildewinitalianwheatcvstrampelli
AT xianchunxia qtlmappingforadultplantresistancetopowderymildewinitalianwheatcvstrampelli
AT yongzhang qtlmappingforadultplantresistancetopowderymildewinitalianwheatcvstrampelli
AT zhonghuhe qtlmappingforadultplantresistancetopowderymildewinitalianwheatcvstrampelli
_version_ 1721392560014884864