QTL Mapping for Adult Plant Resistance to Powdery Mildew in Italian Wheat cv. Strampelli
The Italian wheat cv. Strampelli displays high resistance to powdery mildew caused by Blumeria graminis f. sp. tritici. The objective of this study was to map quantitative trait loci (QTLs) for resistance to powdery mildew in a population of 249 F2:3 lines from Strampelli/Huixianhong. Adult plant po...
Main Authors: | , , , , , , |
---|---|
Format: | Article |
Language: | English |
Published: |
Elsevier
2013-05-01
|
Series: | Journal of Integrative Agriculture |
Subjects: | |
Online Access: | http://www.sciencedirect.com/science/article/pii/S209531191360297X |
id |
doaj-e0760bc0ac1d4b068826ac994fdb5e36 |
---|---|
record_format |
Article |
spelling |
doaj-e0760bc0ac1d4b068826ac994fdb5e362021-06-07T06:48:33ZengElsevierJournal of Integrative Agriculture2095-31192013-05-01125756764QTL Mapping for Adult Plant Resistance to Powdery Mildew in Italian Wheat cv. StrampelliMuhammad Azeem Asad0Bin BAI1Cai-xia LAN2Jun YAN3Xian-chun XIA4Yong ZHANG5Zhong-hu HE6National Wheat Improvement Center/National Key Facility for Crop Gene Resources and Genetic Improvement/Institute of Crop Sciences, Chinese Academy of Agricultural Sciences (CAAS), Beijing 100081, P.R. ChinaNational Wheat Improvement Center/National Key Facility for Crop Gene Resources and Genetic Improvement/Institute of Crop Sciences, Chinese Academy of Agricultural Sciences (CAAS), Beijing 100081, P.R. ChinaNational Wheat Improvement Center/National Key Facility for Crop Gene Resources and Genetic Improvement/Institute of Crop Sciences, Chinese Academy of Agricultural Sciences (CAAS), Beijing 100081, P.R. ChinaCotton Research Institute, Chinese Academy of Agricultural Sciences (CAAS), Anyang 455000, P.R. ChinaNational Wheat Improvement Center/National Key Facility for Crop Gene Resources and Genetic Improvement/Institute of Crop Sciences, Chinese Academy of Agricultural Sciences (CAAS), Beijing 100081, P.R. ChinaNational Wheat Improvement Center/National Key Facility for Crop Gene Resources and Genetic Improvement/Institute of Crop Sciences, Chinese Academy of Agricultural Sciences (CAAS), Beijing 100081, P.R. ChinaNational Wheat Improvement Center/National Key Facility for Crop Gene Resources and Genetic Improvement/Institute of Crop Sciences, Chinese Academy of Agricultural Sciences (CAAS), Beijing 100081, P.R. China; International Maize and Wheat Improvement Center (CIMMYT) China Office, Beijing 100081, P.R. China; Correspondence HE Zhong-hu, Tel: +86-10-82108547The Italian wheat cv. Strampelli displays high resistance to powdery mildew caused by Blumeria graminis f. sp. tritici. The objective of this study was to map quantitative trait loci (QTLs) for resistance to powdery mildew in a population of 249 F2:3 lines from Strampelli/Huixianhong. Adult plant powdery mildew tests were conducted over 2 yr in Beijing and 1 yr in Anyang and simple sequence repeat (SSR) markers were used for genotyping. QTLs Qpm.caas-3BS, Qpm.caas-5BL.1, and Qpm.caas-7DS were consistent across environments whereas, Qpm.caas-2BS.1 found in two environments, explained 0.4–1.6, 5.5–6.9, 27.1–34.5, and 1.0–3.5% of the phenotypic variation respectively. Qpm.caas-7DS corresponded to the genomic location of Pm38/Lr34/Yr18. Qpm.caas-4BL was identified in Anyang 2010 and Beijing 2011, accounting for 1.9–3.5% of phenotypic variation. Qpm.caas-2BS.1 and Qpm.caas-5BL.1 contributed by Strampelli and Qpm.caas-3BS by Huixianhong, seem to be new QTL for powdery mildew resistance. Qpm.caas-4BL, Qpm.caas-5BL.3, and Qpm.caas-7DS contributed by Strampelli appeared to be in the same genomic regions as those mapped previously for stripe rust resistance in the same population, indicating that these loci conferred resistance to both stripe rust and powdery mildew. Strampelli could be a valuable genetic resource for improving durable resistance to both powdery mildew and stripe rust in wheat.http://www.sciencedirect.com/science/article/pii/S209531191360297XQTL analysisSSR markersBlumeria graminisdurable resistanceTriticum aestivum L |
collection |
DOAJ |
language |
English |
format |
Article |
sources |
DOAJ |
author |
Muhammad Azeem Asad Bin BAI Cai-xia LAN Jun YAN Xian-chun XIA Yong ZHANG Zhong-hu HE |
spellingShingle |
Muhammad Azeem Asad Bin BAI Cai-xia LAN Jun YAN Xian-chun XIA Yong ZHANG Zhong-hu HE QTL Mapping for Adult Plant Resistance to Powdery Mildew in Italian Wheat cv. Strampelli Journal of Integrative Agriculture QTL analysis SSR markers Blumeria graminis durable resistance Triticum aestivum L |
author_facet |
Muhammad Azeem Asad Bin BAI Cai-xia LAN Jun YAN Xian-chun XIA Yong ZHANG Zhong-hu HE |
author_sort |
Muhammad Azeem Asad |
title |
QTL Mapping for Adult Plant Resistance to Powdery Mildew in Italian Wheat cv. Strampelli |
title_short |
QTL Mapping for Adult Plant Resistance to Powdery Mildew in Italian Wheat cv. Strampelli |
title_full |
QTL Mapping for Adult Plant Resistance to Powdery Mildew in Italian Wheat cv. Strampelli |
title_fullStr |
QTL Mapping for Adult Plant Resistance to Powdery Mildew in Italian Wheat cv. Strampelli |
title_full_unstemmed |
QTL Mapping for Adult Plant Resistance to Powdery Mildew in Italian Wheat cv. Strampelli |
title_sort |
qtl mapping for adult plant resistance to powdery mildew in italian wheat cv. strampelli |
publisher |
Elsevier |
series |
Journal of Integrative Agriculture |
issn |
2095-3119 |
publishDate |
2013-05-01 |
description |
The Italian wheat cv. Strampelli displays high resistance to powdery mildew caused by Blumeria graminis f. sp. tritici. The objective of this study was to map quantitative trait loci (QTLs) for resistance to powdery mildew in a population of 249 F2:3 lines from Strampelli/Huixianhong. Adult plant powdery mildew tests were conducted over 2 yr in Beijing and 1 yr in Anyang and simple sequence repeat (SSR) markers were used for genotyping. QTLs Qpm.caas-3BS, Qpm.caas-5BL.1, and Qpm.caas-7DS were consistent across environments whereas, Qpm.caas-2BS.1 found in two environments, explained 0.4–1.6, 5.5–6.9, 27.1–34.5, and 1.0–3.5% of the phenotypic variation respectively. Qpm.caas-7DS corresponded to the genomic location of Pm38/Lr34/Yr18. Qpm.caas-4BL was identified in Anyang 2010 and Beijing 2011, accounting for 1.9–3.5% of phenotypic variation. Qpm.caas-2BS.1 and Qpm.caas-5BL.1 contributed by Strampelli and Qpm.caas-3BS by Huixianhong, seem to be new QTL for powdery mildew resistance. Qpm.caas-4BL, Qpm.caas-5BL.3, and Qpm.caas-7DS contributed by Strampelli appeared to be in the same genomic regions as those mapped previously for stripe rust resistance in the same population, indicating that these loci conferred resistance to both stripe rust and powdery mildew. Strampelli could be a valuable genetic resource for improving durable resistance to both powdery mildew and stripe rust in wheat. |
topic |
QTL analysis SSR markers Blumeria graminis durable resistance Triticum aestivum L |
url |
http://www.sciencedirect.com/science/article/pii/S209531191360297X |
work_keys_str_mv |
AT muhammadazeemasad qtlmappingforadultplantresistancetopowderymildewinitalianwheatcvstrampelli AT binbai qtlmappingforadultplantresistancetopowderymildewinitalianwheatcvstrampelli AT caixialan qtlmappingforadultplantresistancetopowderymildewinitalianwheatcvstrampelli AT junyan qtlmappingforadultplantresistancetopowderymildewinitalianwheatcvstrampelli AT xianchunxia qtlmappingforadultplantresistancetopowderymildewinitalianwheatcvstrampelli AT yongzhang qtlmappingforadultplantresistancetopowderymildewinitalianwheatcvstrampelli AT zhonghuhe qtlmappingforadultplantresistancetopowderymildewinitalianwheatcvstrampelli |
_version_ |
1721392560014884864 |