The Role of Active-Site Plasticity in Damaged-Nucleotide Recognition by Human Apurinic/Apyrimidinic Endonuclease APE1

Human apurinic/apyrimidinic (AP) endonuclease APE1 hydrolyzes phosphodiester bonds on the 5′ side of an AP-site, and some damaged nucleotides such as 1,N6-ethenoadenosine (εA), α-adenosine (αA), and 5,6-dihydrouridine (DHU). To investigate the mechanism behind the broad substrate specificity of APE1...

Full description

Bibliographic Details
Main Authors: Anatoly A. Bulygin, Alexandra A. Kuznetsova, Yuri N. Vorobjev, Olga S. Fedorova, Nikita A. Kuznetsov
Format: Article
Language:English
Published: MDPI AG 2020-08-01
Series:Molecules
Subjects:
Online Access:https://www.mdpi.com/1420-3049/25/17/3940
id doaj-ea5ae82b6e054a4a97c421a1ff648bbb
record_format Article
spelling doaj-ea5ae82b6e054a4a97c421a1ff648bbb2020-11-25T03:54:53ZengMDPI AGMolecules1420-30492020-08-01253940394010.3390/molecules25173940The Role of Active-Site Plasticity in Damaged-Nucleotide Recognition by Human Apurinic/Apyrimidinic Endonuclease APE1Anatoly A. Bulygin0Alexandra A. Kuznetsova1Yuri N. Vorobjev2Olga S. Fedorova3Nikita A. Kuznetsov4Institute of Chemical Biology and Fundamental Medicine, Lavrentyev Ave. 8, 630090 Novosibirsk, RussiaInstitute of Chemical Biology and Fundamental Medicine, Lavrentyev Ave. 8, 630090 Novosibirsk, RussiaInstitute of Chemical Biology and Fundamental Medicine, Lavrentyev Ave. 8, 630090 Novosibirsk, RussiaInstitute of Chemical Biology and Fundamental Medicine, Lavrentyev Ave. 8, 630090 Novosibirsk, RussiaInstitute of Chemical Biology and Fundamental Medicine, Lavrentyev Ave. 8, 630090 Novosibirsk, RussiaHuman apurinic/apyrimidinic (AP) endonuclease APE1 hydrolyzes phosphodiester bonds on the 5′ side of an AP-site, and some damaged nucleotides such as 1,N6-ethenoadenosine (εA), α-adenosine (αA), and 5,6-dihydrouridine (DHU). To investigate the mechanism behind the broad substrate specificity of APE1, we analyzed pre-steady-state kinetics of conformational changes in DNA and the enzyme during DNA binding and damage recognition. Molecular dynamics simulations of APE1 complexes with one of damaged DNA duplexes containing εA, αA, DHU, or an F-site (a stable analog of an AP-site) revealed the involvement of residues Asn229, Thr233, and Glu236 in the mechanism of DNA lesion recognition. The results suggested that processing of an AP-site proceeds faster in comparison with nucleotide incision repair substrates because eversion of a small abasic site and its insertion into the active site do not include any unfavorable interactions, whereas the insertion of any target nucleotide containing a damaged base into the APE1 active site is sterically hindered. Destabilization of the α-helix containing Thr233 and Glu236 via a loss of the interaction between these residues increased the plasticity of the damaged-nucleotide binding pocket and the ability to accommodate structurally different damaged nucleotides. Nonetheless, the optimal location of εA or αA in the binding pocket does not correspond to the optimal conformation of catalytic amino acid residues, thereby significantly decreasing the cleavage efficacy for these substrates.https://www.mdpi.com/1420-3049/25/17/3940base excision repairAP endonucleaseconformational dynamicsactive site plasticityapurinic/apyrimidinic site5,6-dihydrouridine
collection DOAJ
language English
format Article
sources DOAJ
author Anatoly A. Bulygin
Alexandra A. Kuznetsova
Yuri N. Vorobjev
Olga S. Fedorova
Nikita A. Kuznetsov
spellingShingle Anatoly A. Bulygin
Alexandra A. Kuznetsova
Yuri N. Vorobjev
Olga S. Fedorova
Nikita A. Kuznetsov
The Role of Active-Site Plasticity in Damaged-Nucleotide Recognition by Human Apurinic/Apyrimidinic Endonuclease APE1
Molecules
base excision repair
AP endonuclease
conformational dynamics
active site plasticity
apurinic/apyrimidinic site
5,6-dihydrouridine
author_facet Anatoly A. Bulygin
Alexandra A. Kuznetsova
Yuri N. Vorobjev
Olga S. Fedorova
Nikita A. Kuznetsov
author_sort Anatoly A. Bulygin
title The Role of Active-Site Plasticity in Damaged-Nucleotide Recognition by Human Apurinic/Apyrimidinic Endonuclease APE1
title_short The Role of Active-Site Plasticity in Damaged-Nucleotide Recognition by Human Apurinic/Apyrimidinic Endonuclease APE1
title_full The Role of Active-Site Plasticity in Damaged-Nucleotide Recognition by Human Apurinic/Apyrimidinic Endonuclease APE1
title_fullStr The Role of Active-Site Plasticity in Damaged-Nucleotide Recognition by Human Apurinic/Apyrimidinic Endonuclease APE1
title_full_unstemmed The Role of Active-Site Plasticity in Damaged-Nucleotide Recognition by Human Apurinic/Apyrimidinic Endonuclease APE1
title_sort role of active-site plasticity in damaged-nucleotide recognition by human apurinic/apyrimidinic endonuclease ape1
publisher MDPI AG
series Molecules
issn 1420-3049
publishDate 2020-08-01
description Human apurinic/apyrimidinic (AP) endonuclease APE1 hydrolyzes phosphodiester bonds on the 5′ side of an AP-site, and some damaged nucleotides such as 1,N6-ethenoadenosine (εA), α-adenosine (αA), and 5,6-dihydrouridine (DHU). To investigate the mechanism behind the broad substrate specificity of APE1, we analyzed pre-steady-state kinetics of conformational changes in DNA and the enzyme during DNA binding and damage recognition. Molecular dynamics simulations of APE1 complexes with one of damaged DNA duplexes containing εA, αA, DHU, or an F-site (a stable analog of an AP-site) revealed the involvement of residues Asn229, Thr233, and Glu236 in the mechanism of DNA lesion recognition. The results suggested that processing of an AP-site proceeds faster in comparison with nucleotide incision repair substrates because eversion of a small abasic site and its insertion into the active site do not include any unfavorable interactions, whereas the insertion of any target nucleotide containing a damaged base into the APE1 active site is sterically hindered. Destabilization of the α-helix containing Thr233 and Glu236 via a loss of the interaction between these residues increased the plasticity of the damaged-nucleotide binding pocket and the ability to accommodate structurally different damaged nucleotides. Nonetheless, the optimal location of εA or αA in the binding pocket does not correspond to the optimal conformation of catalytic amino acid residues, thereby significantly decreasing the cleavage efficacy for these substrates.
topic base excision repair
AP endonuclease
conformational dynamics
active site plasticity
apurinic/apyrimidinic site
5,6-dihydrouridine
url https://www.mdpi.com/1420-3049/25/17/3940
work_keys_str_mv AT anatolyabulygin theroleofactivesiteplasticityindamagednucleotiderecognitionbyhumanapurinicapyrimidinicendonucleaseape1
AT alexandraakuznetsova theroleofactivesiteplasticityindamagednucleotiderecognitionbyhumanapurinicapyrimidinicendonucleaseape1
AT yurinvorobjev theroleofactivesiteplasticityindamagednucleotiderecognitionbyhumanapurinicapyrimidinicendonucleaseape1
AT olgasfedorova theroleofactivesiteplasticityindamagednucleotiderecognitionbyhumanapurinicapyrimidinicendonucleaseape1
AT nikitaakuznetsov theroleofactivesiteplasticityindamagednucleotiderecognitionbyhumanapurinicapyrimidinicendonucleaseape1
AT anatolyabulygin roleofactivesiteplasticityindamagednucleotiderecognitionbyhumanapurinicapyrimidinicendonucleaseape1
AT alexandraakuznetsova roleofactivesiteplasticityindamagednucleotiderecognitionbyhumanapurinicapyrimidinicendonucleaseape1
AT yurinvorobjev roleofactivesiteplasticityindamagednucleotiderecognitionbyhumanapurinicapyrimidinicendonucleaseape1
AT olgasfedorova roleofactivesiteplasticityindamagednucleotiderecognitionbyhumanapurinicapyrimidinicendonucleaseape1
AT nikitaakuznetsov roleofactivesiteplasticityindamagednucleotiderecognitionbyhumanapurinicapyrimidinicendonucleaseape1
_version_ 1724472073804316672