Nutritional interventions among community-dwelling frail elderly : a systematic review

Background: The worldwide ageing demographic trend has resulted in a growing number of frail elderly who are in the last stages of autonomous living. Oral nutritional interventions for the frail elderly address the body’s natural weight loss, sometimes reversing weight loss, though the literature is...

Full description

Bibliographic Details
Main Authors: Wang, Miranda, 王慕恩
Language:English
Published: The University of Hong Kong (Pokfulam, Hong Kong) 2014
Subjects:
Online Access:http://hdl.handle.net/10722/193851
id ndltd-HKU-oai-hub.hku.hk-10722-193851
record_format oai_dc
spelling ndltd-HKU-oai-hub.hku.hk-10722-1938512015-07-29T04:02:23Z Nutritional interventions among community-dwelling frail elderly : a systematic review Wang, Miranda 王慕恩 Frail elderly - Nutrition Background: The worldwide ageing demographic trend has resulted in a growing number of frail elderly who are in the last stages of autonomous living. Oral nutritional interventions for the frail elderly address the body’s natural weight loss, sometimes reversing weight loss, though the literature is not of one accord. No review of nutritional interventions has been conducted for community-dwelling frail elderly, who are most likely to benefit from these interventions and delay adverse outcomes. Objective: (i) This systematic review analyzes results from randomized controlled trials of oral nutrition interventions for the community-dwelling frail elderly to determine their efficacy in making gains in nutritional and functional status. (ii) The secondary objective is to analyze the quality of the studies in this review and draw conclusions for further areas of development in the field of nutrition in elderly care. Methods: Randomized controlled trials of oral nutritional supplements were searched in The Cochrane Library and PubMed, and hand searched in reference lists of systematic reviews. These interventions targeted protein-energy deficiency and included oral supplementation or supplementation paired with exercise compared to a placebo or usual practice. Community-dwelling frail elderly not institutionalized or hospitalized were eligible. Studies targeting disease-specific elderly were excluded. Results: Out of 120 search results, six trials were included in this review. A small weight gain from oral nutritional interventions among frail community-dwelling elderly was reported in five out of six studies. Functional status did not improve significantly with the interventions. Studies used unstandardized definitions and different ways to measure outcomes, resulting in heterogeneity. Conclusions: The few and poor quality of studies demonstrates the need for more studies of better quality and homogeneity assessing oral nutritional interventions for nutritional and functional gain in frail elderly who are not yet suffering from adverse outcomes. published_or_final_version Public Health Master Master of Public Health 2014-01-27T23:10:52Z 2014-01-27T23:10:52Z 2013 2013 PG_Thesis 10.5353/th_b5094872 b5094872 http://hdl.handle.net/10722/193851 eng HKU Theses Online (HKUTO) The author retains all proprietary rights, (such as patent rights) and the right to use in future works. Creative Commons: Attribution 3.0 Hong Kong License The University of Hong Kong (Pokfulam, Hong Kong)
collection NDLTD
language English
sources NDLTD
topic Frail elderly - Nutrition
spellingShingle Frail elderly - Nutrition
Wang, Miranda
王慕恩
Nutritional interventions among community-dwelling frail elderly : a systematic review
description Background: The worldwide ageing demographic trend has resulted in a growing number of frail elderly who are in the last stages of autonomous living. Oral nutritional interventions for the frail elderly address the body’s natural weight loss, sometimes reversing weight loss, though the literature is not of one accord. No review of nutritional interventions has been conducted for community-dwelling frail elderly, who are most likely to benefit from these interventions and delay adverse outcomes. Objective: (i) This systematic review analyzes results from randomized controlled trials of oral nutrition interventions for the community-dwelling frail elderly to determine their efficacy in making gains in nutritional and functional status. (ii) The secondary objective is to analyze the quality of the studies in this review and draw conclusions for further areas of development in the field of nutrition in elderly care. Methods: Randomized controlled trials of oral nutritional supplements were searched in The Cochrane Library and PubMed, and hand searched in reference lists of systematic reviews. These interventions targeted protein-energy deficiency and included oral supplementation or supplementation paired with exercise compared to a placebo or usual practice. Community-dwelling frail elderly not institutionalized or hospitalized were eligible. Studies targeting disease-specific elderly were excluded. Results: Out of 120 search results, six trials were included in this review. A small weight gain from oral nutritional interventions among frail community-dwelling elderly was reported in five out of six studies. Functional status did not improve significantly with the interventions. Studies used unstandardized definitions and different ways to measure outcomes, resulting in heterogeneity. Conclusions: The few and poor quality of studies demonstrates the need for more studies of better quality and homogeneity assessing oral nutritional interventions for nutritional and functional gain in frail elderly who are not yet suffering from adverse outcomes. === published_or_final_version === Public Health === Master === Master of Public Health
author Wang, Miranda
王慕恩
author_facet Wang, Miranda
王慕恩
author_sort Wang, Miranda
title Nutritional interventions among community-dwelling frail elderly : a systematic review
title_short Nutritional interventions among community-dwelling frail elderly : a systematic review
title_full Nutritional interventions among community-dwelling frail elderly : a systematic review
title_fullStr Nutritional interventions among community-dwelling frail elderly : a systematic review
title_full_unstemmed Nutritional interventions among community-dwelling frail elderly : a systematic review
title_sort nutritional interventions among community-dwelling frail elderly : a systematic review
publisher The University of Hong Kong (Pokfulam, Hong Kong)
publishDate 2014
url http://hdl.handle.net/10722/193851
work_keys_str_mv AT wangmiranda nutritionalinterventionsamongcommunitydwellingfrailelderlyasystematicreview
AT wángmùēn nutritionalinterventionsamongcommunitydwellingfrailelderlyasystematicreview
_version_ 1716814072093081600