Design och konstruktion av mätuppställning för induktiv mätning av magnetisk spinndynamik

Development in spin dynamic occurs in the whole world because of therising demands on fast electronic storage for example hard drivesand RAM (Random Access Memory). Measuring the spin resonance of amaterial gives you the insight of the theoretical speed for amagnetic memory. This means the maximum s...

Full description

Bibliographic Details
Main Author: Törnman, Ville
Format: Others
Language:Swedish
Published: Uppsala universitet, Fasta tillståndets fysik 2010
Subjects:
Online Access:http://urn.kb.se/resolve?urn=urn:nbn:se:uu:diva-122249
id ndltd-UPSALLA1-oai-DiVA.org-uu-122249
record_format oai_dc
spelling ndltd-UPSALLA1-oai-DiVA.org-uu-1222492013-01-08T13:49:00ZDesign och konstruktion av mätuppställning för induktiv mätning av magnetisk spinndynamiksweDesign and construction of measurement setup for inductive measurement of magnetic spin dynamicsTörnman, VilleUppsala universitet, Fasta tillståndets fysik2010magnetisk spinndynamikKittelGilbertDevelopment in spin dynamic occurs in the whole world because of therising demands on fast electronic storage for example hard drivesand RAM (Random Access Memory). Measuring the spin resonance of amaterial gives you the insight of the theoretical speed for amagnetic memory. This means the maximum storage speed is below thefirst resonance. All magnetic materials have different propertiesthat will inflict the resonance frequency which brings that theconstructors of memories need to know which magnetic material theywill use to obtain best results. In the market for normal users themaximum storage speed in a RAM memory is 1.6 GHz. But the memoriesdoes not have magnetic properties because they are made oftransistors. The disadvantages in transistors is that they lose alldata when the power is off. The target of  the diploma thesis is toconstruct the first experiential setup for spin dynamics in Swedenconsisting of a network analyser, waveguide, microwave probes andadjustable magnetic DC-field. The thesis work also included a tripto Germany for measuring on a similar material to achieve someverification on the quality off the measurement setup. Themeasurement setup measure the transmission losses that occur atferromagnetic resonance which are detected by the Network Analyser,the losses are comparable with the susceptibly in themagnetic material which could be derived from the magnetic precisionby Landau-Lifshitz- Gilbert (LLG) equation. The thesis contains somepractical elements like constructing a waveguide by opticallithography, constructing a Helmholtz coil to change the resonancefrequency in the material according to Kittels equation and also amagnetic setup to saturate the rf-field to receive the backgrounddistortion in the measurement for elimination in the spin dynamicmeasurement. Time schedule for the thesis is 20 weeks and the thelocation are at Uppsala University at the institution of solid statephysics. Student thesisinfo:eu-repo/semantics/bachelorThesistexthttp://urn.kb.se/resolve?urn=urn:nbn:se:uu:diva-122249UPTEC F, 1401-5757 ; 10023application/pdfinfo:eu-repo/semantics/openAccess
collection NDLTD
language Swedish
format Others
sources NDLTD
topic magnetisk spinndynamik
Kittel
Gilbert
spellingShingle magnetisk spinndynamik
Kittel
Gilbert
Törnman, Ville
Design och konstruktion av mätuppställning för induktiv mätning av magnetisk spinndynamik
description Development in spin dynamic occurs in the whole world because of therising demands on fast electronic storage for example hard drivesand RAM (Random Access Memory). Measuring the spin resonance of amaterial gives you the insight of the theoretical speed for amagnetic memory. This means the maximum storage speed is below thefirst resonance. All magnetic materials have different propertiesthat will inflict the resonance frequency which brings that theconstructors of memories need to know which magnetic material theywill use to obtain best results. In the market for normal users themaximum storage speed in a RAM memory is 1.6 GHz. But the memoriesdoes not have magnetic properties because they are made oftransistors. The disadvantages in transistors is that they lose alldata when the power is off. The target of  the diploma thesis is toconstruct the first experiential setup for spin dynamics in Swedenconsisting of a network analyser, waveguide, microwave probes andadjustable magnetic DC-field. The thesis work also included a tripto Germany for measuring on a similar material to achieve someverification on the quality off the measurement setup. Themeasurement setup measure the transmission losses that occur atferromagnetic resonance which are detected by the Network Analyser,the losses are comparable with the susceptibly in themagnetic material which could be derived from the magnetic precisionby Landau-Lifshitz- Gilbert (LLG) equation. The thesis contains somepractical elements like constructing a waveguide by opticallithography, constructing a Helmholtz coil to change the resonancefrequency in the material according to Kittels equation and also amagnetic setup to saturate the rf-field to receive the backgrounddistortion in the measurement for elimination in the spin dynamicmeasurement. Time schedule for the thesis is 20 weeks and the thelocation are at Uppsala University at the institution of solid statephysics.
author Törnman, Ville
author_facet Törnman, Ville
author_sort Törnman, Ville
title Design och konstruktion av mätuppställning för induktiv mätning av magnetisk spinndynamik
title_short Design och konstruktion av mätuppställning för induktiv mätning av magnetisk spinndynamik
title_full Design och konstruktion av mätuppställning för induktiv mätning av magnetisk spinndynamik
title_fullStr Design och konstruktion av mätuppställning för induktiv mätning av magnetisk spinndynamik
title_full_unstemmed Design och konstruktion av mätuppställning för induktiv mätning av magnetisk spinndynamik
title_sort design och konstruktion av mätuppställning för induktiv mätning av magnetisk spinndynamik
publisher Uppsala universitet, Fasta tillståndets fysik
publishDate 2010
url http://urn.kb.se/resolve?urn=urn:nbn:se:uu:diva-122249
work_keys_str_mv AT tornmanville designochkonstruktionavmatuppstallningforinduktivmatningavmagnetiskspinndynamik
AT tornmanville designandconstructionofmeasurementsetupforinductivemeasurementofmagneticspindynamics
_version_ 1716529610059939840