Analysis of DNA sequence variants in candidate genes for bovine spongiform encephalopathy (BSE) susceptibility located in a QTL region on bovine chromosome 17q23-q24
| Main Author: | |
|---|---|
| Other Authors: | |
| Format: | Doctoral Thesis |
| Language: | English |
| Published: |
2010
|
| Subjects: | |
| Online Access: | http://hdl.handle.net/11858/00-1735-0000-0006-B047-A http://nbn-resolving.de/urn:nbn:de:gbv:7-webdoc-2370-9 |
| id |
ndltd-uni-goettingen.de-oai-ediss.uni-goettingen.de-11858-00-1735-0000-0006-B047-A |
|---|---|
| record_format |
oai_dc |
| spelling |
ndltd-uni-goettingen.de-oai-ediss.uni-goettingen.de-11858-00-1735-0000-0006-B047-A2014-01-03T04:55:29ZAnalysis of DNA sequence variants in candidate genes for bovine spongiform encephalopathy (BSE) susceptibility located in a QTL region on bovine chromosome 17q23-q24Die Analyse der DNA-Sequenz-Varianten in Kandidatengenen für Bovine Spongiforme Enzephalopathie (BSE) Empfindlichkeit liegt in einer QTL-Region auf Chromosom 17q23 Rinder-q24Morina, Rifat590 Tiere (Zoologie)Agricultural SciencesBSEKandidatengeneHolstein FriesianGerman SimmentalBrown SwissBSECandidate geneHOlstein FriesianGermann SimmentalBrown Swiss42.13WF 200: MolekularbiologieBrenig, Bertram Prof. Dr. Dr.2010-02-08T14:39:42Z2013-01-18T10:17:46Z2013-01-30T23:51:20Z2010-02-082009-11-19doctoralThesisapplication/pdfhttp://hdl.handle.net/11858/00-1735-0000-0006-B047-Aurn:nbn:de:gbv:7-webdoc-2370-9webdoc-2370619489219enghttp://webdoc.sub.gwdg.de/diss/copyr_diss.html |
| collection |
NDLTD |
| language |
English |
| format |
Doctoral Thesis |
| sources |
NDLTD |
| topic |
590 Tiere (Zoologie) Agricultural Sciences BSE Kandidatengene Holstein Friesian German Simmental Brown Swiss BSE Candidate gene HOlstein Friesian Germann Simmental Brown Swiss 42.13 WF 200: Molekularbiologie |
| spellingShingle |
590 Tiere (Zoologie) Agricultural Sciences BSE Kandidatengene Holstein Friesian German Simmental Brown Swiss BSE Candidate gene HOlstein Friesian Germann Simmental Brown Swiss 42.13 WF 200: Molekularbiologie Morina, Rifat Analysis of DNA sequence variants in candidate genes for bovine spongiform encephalopathy (BSE) susceptibility located in a QTL region on bovine chromosome 17q23-q24 |
| author2 |
Brenig, Bertram Prof. Dr. Dr. |
| author_facet |
Brenig, Bertram Prof. Dr. Dr. Morina, Rifat |
| author |
Morina, Rifat |
| author_sort |
Morina, Rifat |
| title |
Analysis of DNA sequence variants in candidate genes for bovine spongiform encephalopathy (BSE) susceptibility located in a QTL region on bovine chromosome 17q23-q24 |
| title_short |
Analysis of DNA sequence variants in candidate genes for bovine spongiform encephalopathy (BSE) susceptibility located in a QTL region on bovine chromosome 17q23-q24 |
| title_full |
Analysis of DNA sequence variants in candidate genes for bovine spongiform encephalopathy (BSE) susceptibility located in a QTL region on bovine chromosome 17q23-q24 |
| title_fullStr |
Analysis of DNA sequence variants in candidate genes for bovine spongiform encephalopathy (BSE) susceptibility located in a QTL region on bovine chromosome 17q23-q24 |
| title_full_unstemmed |
Analysis of DNA sequence variants in candidate genes for bovine spongiform encephalopathy (BSE) susceptibility located in a QTL region on bovine chromosome 17q23-q24 |
| title_sort |
analysis of dna sequence variants in candidate genes for bovine spongiform encephalopathy (bse) susceptibility located in a qtl region on bovine chromosome 17q23-q24 |
| publishDate |
2010 |
| url |
http://hdl.handle.net/11858/00-1735-0000-0006-B047-A http://nbn-resolving.de/urn:nbn:de:gbv:7-webdoc-2370-9 |
| work_keys_str_mv |
AT morinarifat analysisofdnasequencevariantsincandidategenesforbovinespongiformencephalopathybsesusceptibilitylocatedinaqtlregiononbovinechromosome17q23q24 AT morinarifat dieanalysederdnasequenzvarianteninkandidatengenenfurbovinespongiformeenzephalopathiebseempfindlichkeitliegtineinerqtlregionaufchromosom17q23rinderq24 |
| _version_ |
1716622511673704448 |