Novel Frog Skin-Derived Peptide Dermaseptin-PP for Lung Cancer Treatment: In vitro/vivo Evaluation and Anti-tumor Mechanisms Study
Lung cancer is the major cause of cancer deaths worldwide, and it has the highest incidence and mortality rate of any cancer among men and women in China. The first-line therapy for lung cancer treatment is platinum-based chemotherapy drugs such as cisplatin. However, the application of present chem...
Main Authors: | , , , , , , , , , , , |
---|---|
Format: | Article |
Language: | English |
Published: |
Frontiers Media S.A.
2020-06-01
|
Series: | Frontiers in Chemistry |
Subjects: | |
Online Access: | https://www.frontiersin.org/article/10.3389/fchem.2020.00476/full |
id |
doaj-8c794598834447d2ae4ec88b47bf0a4c |
---|---|
record_format |
Article |
spelling |
doaj-8c794598834447d2ae4ec88b47bf0a4c2020-11-25T03:31:55ZengFrontiers Media S.A.Frontiers in Chemistry2296-26462020-06-01810.3389/fchem.2020.00476541180Novel Frog Skin-Derived Peptide Dermaseptin-PP for Lung Cancer Treatment: In vitro/vivo Evaluation and Anti-tumor Mechanisms StudyZiyi Dong0Haiyan Hu1Xianglong Yu2Li Tan3Chengbang Ma4Xinping Xi5Lei Li6Lei Wang7Mei Zhou8Tianbao Chen9Shouying Du10Yang Lu11Laboratory of Traditional Chinese Medicine, School of Chinese Materia Medica, Beijing University of Chinese Medicine, Beijing, ChinaLaboratory of Traditional Chinese Medicine, School of Chinese Materia Medica, Beijing University of Chinese Medicine, Beijing, ChinaLaboratory of Traditional Chinese Medicine, School of Chinese Materia Medica, Beijing University of Chinese Medicine, Beijing, ChinaLivzon Pharmaceutical Group Inc., Zhuhai, ChinaNatural Drug Discovery Group, School of Pharmacy, Queen's University, Belfast, United KingdomNatural Drug Discovery Group, School of Pharmacy, Queen's University, Belfast, United KingdomDepartment of Biotechnology, Beijing Institute of Radiation Medicine, Beijing, ChinaNatural Drug Discovery Group, School of Pharmacy, Queen's University, Belfast, United KingdomNatural Drug Discovery Group, School of Pharmacy, Queen's University, Belfast, United KingdomNatural Drug Discovery Group, School of Pharmacy, Queen's University, Belfast, United KingdomLaboratory of Traditional Chinese Medicine, School of Chinese Materia Medica, Beijing University of Chinese Medicine, Beijing, ChinaLaboratory of Traditional Chinese Medicine, School of Chinese Materia Medica, Beijing University of Chinese Medicine, Beijing, ChinaLung cancer is the major cause of cancer deaths worldwide, and it has the highest incidence and mortality rate of any cancer among men and women in China. The first-line therapy for lung cancer treatment is platinum-based chemotherapy drugs such as cisplatin. However, the application of present chemotherapies is limited by severe side effects, which stimulates the discovery of new drugs with new anti-tumor mechanisms and fewer side effects. Beneficially, many antimicrobial peptides (AMPs) from frog skin have been reported to exhibit potent anti-cancer activities with low toxicity, high selectivity and a low propensity to induce resistance. In this study, we first reported an AMP named Dermaseptin-PP, from a rarely studied frog species, Phyllomedusa palliata. Dermaseptin-PP exhibited selective cytotoxicity on H157, MCF-7, PC-3, and U251 MG cancer cells instead of normal HMEC-1 cells with low hemolytic effect. Furthermore, on subcutaneous H157 tumor model of nude mice, Dermaseptin-PP was found to display potent in vivo anti-tumor activity in a dose-related manner without obvious hepatopulmonary side effects. It is widely accepted that AMPs usually work through a membrane disruptive mode, and the confocal laser microscope observation confirmed that Dermaseptin-PP could destroy H157 cell membranes. Further investigation of mechanisms by flow cytometry assay and immunohistochemical analysis unraveled that Dermaseptin-PP also exerted its anti-tumor activity by inducing H157 cell apoptosis via both endogenous mitochondrial apoptosis pathway and exogenous death receptor apoptosis pathway. Herein, we emphasize that the membrane disrupting and the apoptosis activation effects of Dermaseptin-PP both depend on its concentration. Overall, a novel frog skin-derived AMP, named Dermaseptin-PP, was identified for the first time. It possesses strong antimicrobial activity and effective anti-tumor activity by distinct mechanisms. This study revealed the possibility of Dermaseptin-PP for lung cancer treatment and provided a new perspective for designing novel AMP-based anti-tumor candidates with low risk of cytotoxicity.https://www.frontiersin.org/article/10.3389/fchem.2020.00476/fullnovel peptide discoverymolecular cloningpeptide synthesisanti-lung cancermembrane destructionapoptosis |
collection |
DOAJ |
language |
English |
format |
Article |
sources |
DOAJ |
author |
Ziyi Dong Haiyan Hu Xianglong Yu Li Tan Chengbang Ma Xinping Xi Lei Li Lei Wang Mei Zhou Tianbao Chen Shouying Du Yang Lu |
spellingShingle |
Ziyi Dong Haiyan Hu Xianglong Yu Li Tan Chengbang Ma Xinping Xi Lei Li Lei Wang Mei Zhou Tianbao Chen Shouying Du Yang Lu Novel Frog Skin-Derived Peptide Dermaseptin-PP for Lung Cancer Treatment: In vitro/vivo Evaluation and Anti-tumor Mechanisms Study Frontiers in Chemistry novel peptide discovery molecular cloning peptide synthesis anti-lung cancer membrane destruction apoptosis |
author_facet |
Ziyi Dong Haiyan Hu Xianglong Yu Li Tan Chengbang Ma Xinping Xi Lei Li Lei Wang Mei Zhou Tianbao Chen Shouying Du Yang Lu |
author_sort |
Ziyi Dong |
title |
Novel Frog Skin-Derived Peptide Dermaseptin-PP for Lung Cancer Treatment: In vitro/vivo Evaluation and Anti-tumor Mechanisms Study |
title_short |
Novel Frog Skin-Derived Peptide Dermaseptin-PP for Lung Cancer Treatment: In vitro/vivo Evaluation and Anti-tumor Mechanisms Study |
title_full |
Novel Frog Skin-Derived Peptide Dermaseptin-PP for Lung Cancer Treatment: In vitro/vivo Evaluation and Anti-tumor Mechanisms Study |
title_fullStr |
Novel Frog Skin-Derived Peptide Dermaseptin-PP for Lung Cancer Treatment: In vitro/vivo Evaluation and Anti-tumor Mechanisms Study |
title_full_unstemmed |
Novel Frog Skin-Derived Peptide Dermaseptin-PP for Lung Cancer Treatment: In vitro/vivo Evaluation and Anti-tumor Mechanisms Study |
title_sort |
novel frog skin-derived peptide dermaseptin-pp for lung cancer treatment: in vitro/vivo evaluation and anti-tumor mechanisms study |
publisher |
Frontiers Media S.A. |
series |
Frontiers in Chemistry |
issn |
2296-2646 |
publishDate |
2020-06-01 |
description |
Lung cancer is the major cause of cancer deaths worldwide, and it has the highest incidence and mortality rate of any cancer among men and women in China. The first-line therapy for lung cancer treatment is platinum-based chemotherapy drugs such as cisplatin. However, the application of present chemotherapies is limited by severe side effects, which stimulates the discovery of new drugs with new anti-tumor mechanisms and fewer side effects. Beneficially, many antimicrobial peptides (AMPs) from frog skin have been reported to exhibit potent anti-cancer activities with low toxicity, high selectivity and a low propensity to induce resistance. In this study, we first reported an AMP named Dermaseptin-PP, from a rarely studied frog species, Phyllomedusa palliata. Dermaseptin-PP exhibited selective cytotoxicity on H157, MCF-7, PC-3, and U251 MG cancer cells instead of normal HMEC-1 cells with low hemolytic effect. Furthermore, on subcutaneous H157 tumor model of nude mice, Dermaseptin-PP was found to display potent in vivo anti-tumor activity in a dose-related manner without obvious hepatopulmonary side effects. It is widely accepted that AMPs usually work through a membrane disruptive mode, and the confocal laser microscope observation confirmed that Dermaseptin-PP could destroy H157 cell membranes. Further investigation of mechanisms by flow cytometry assay and immunohistochemical analysis unraveled that Dermaseptin-PP also exerted its anti-tumor activity by inducing H157 cell apoptosis via both endogenous mitochondrial apoptosis pathway and exogenous death receptor apoptosis pathway. Herein, we emphasize that the membrane disrupting and the apoptosis activation effects of Dermaseptin-PP both depend on its concentration. Overall, a novel frog skin-derived AMP, named Dermaseptin-PP, was identified for the first time. It possesses strong antimicrobial activity and effective anti-tumor activity by distinct mechanisms. This study revealed the possibility of Dermaseptin-PP for lung cancer treatment and provided a new perspective for designing novel AMP-based anti-tumor candidates with low risk of cytotoxicity. |
topic |
novel peptide discovery molecular cloning peptide synthesis anti-lung cancer membrane destruction apoptosis |
url |
https://www.frontiersin.org/article/10.3389/fchem.2020.00476/full |
work_keys_str_mv |
AT ziyidong novelfrogskinderivedpeptidedermaseptinppforlungcancertreatmentinvitrovivoevaluationandantitumormechanismsstudy AT haiyanhu novelfrogskinderivedpeptidedermaseptinppforlungcancertreatmentinvitrovivoevaluationandantitumormechanismsstudy AT xianglongyu novelfrogskinderivedpeptidedermaseptinppforlungcancertreatmentinvitrovivoevaluationandantitumormechanismsstudy AT litan novelfrogskinderivedpeptidedermaseptinppforlungcancertreatmentinvitrovivoevaluationandantitumormechanismsstudy AT chengbangma novelfrogskinderivedpeptidedermaseptinppforlungcancertreatmentinvitrovivoevaluationandantitumormechanismsstudy AT xinpingxi novelfrogskinderivedpeptidedermaseptinppforlungcancertreatmentinvitrovivoevaluationandantitumormechanismsstudy AT leili novelfrogskinderivedpeptidedermaseptinppforlungcancertreatmentinvitrovivoevaluationandantitumormechanismsstudy AT leiwang novelfrogskinderivedpeptidedermaseptinppforlungcancertreatmentinvitrovivoevaluationandantitumormechanismsstudy AT meizhou novelfrogskinderivedpeptidedermaseptinppforlungcancertreatmentinvitrovivoevaluationandantitumormechanismsstudy AT tianbaochen novelfrogskinderivedpeptidedermaseptinppforlungcancertreatmentinvitrovivoevaluationandantitumormechanismsstudy AT shouyingdu novelfrogskinderivedpeptidedermaseptinppforlungcancertreatmentinvitrovivoevaluationandantitumormechanismsstudy AT yanglu novelfrogskinderivedpeptidedermaseptinppforlungcancertreatmentinvitrovivoevaluationandantitumormechanismsstudy |
_version_ |
1724570877471752192 |